LXL04_018132 | RubberDandelionOmics

Gene overview

LXL04_018132

Reference: OH-1004 Chr: Chr04 Coordinates: 7051568-7052066 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

255 bp · LXL04_018132|LXL04_018132|OH1004|cDNA

ATGTATAGCAGGAATTATGACCACTACATCGACCGAAGGTTTGCGATATACTGCAACACGAAACCGATCCCGACTACGCAGCCTCATTGGTGCTTGAATCAAGAACCTGAGAAGGAGTCGGTACCTGGCGAACACAAAGAAGCTTTAGTTGCTGCCGATTACATGCCCGATATCATTCTCAGAGAGCAAGGTGTAATCGACGTCGCCCGACATCCCGATTGTGTGACTCTAGTCATGAAGTTTAGCTTTAGATAA

CDS

Download CDS FASTA

255 bp · LXL04_018132|LXL04_018132|OH1004|CDS

ATGTATAGCAGGAATTATGACCACTACATCGACCGAAGGTTTGCGATATACTGCAACACGAAACCGATCCCGACTACGCAGCCTCATTGGTGCTTGAATCAAGAACCTGAGAAGGAGTCGGTACCTGGCGAACACAAAGAAGCTTTAGTTGCTGCCGATTACATGCCCGATATCATTCTCAGAGAGCAAGGTGTAATCGACGTCGCCCGACATCCCGATTGTGTGACTCTAGTCATGAAGTTTAGCTTTAGATAA

Protein

Download Protein FASTA

84 aa · LXL04_018132|LXL04_018132|OH1004|PROTEIN

MYSRNYDHYIDRRFAIYCNTKPIPTTQPHWCLNQEPEKESVPGEHKEALVAADYMPDIILREQGVIDVARHPDCVTLVMKFSFR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018132`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018132

Location Chr04:7051568-7052066 (+)

Description Similar to DXR: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g62790`	Enzyme of the plastid non-mevalonate pathway for isoprenoid biosynthesis that catalyzes the NADPH-dependent rearrangement and reduction of 1-deoxy-D-xylulose-5-phosphate (DXP) to 2-C-methyl-D-erythritol 4-phosphate (MEP).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0106900`	Enzyme of the plastid non-mevalonate pathway for isoprenoid biosynthesis that catalyzes the NADPH-dependent rearrangement and reduction of 1-deoxy-D-xylulose-5-phosphate (DXP) to 2-C-methyl-D-erythritol 4-phosphate (MEP).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018132 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0008299 isoprenoid biosynthetic process Biological Process

GO:0019288 isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway Biological Process

GO:0051484 isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway involved in terpenoid biosynthetic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0030145 manganese ion binding Molecular Function

GO:0030604 1-deoxy-D-xylulose-5-phosphate reductoisomerase activity Molecular Function

GO:0070402 NADPH binding Molecular Function

KEGG gene cross-reference

ath:AT5G62790

dosa:Os01g0106900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.386

Rank 1 · LXL04_018132 · OH-1004

Cytoplasm0.381

Rank 2 · LXL04_018132 · OH-1004

Mitochondrion0.181

Rank 3 · LXL04_018132 · OH-1004

Extracellular0.080

Rank 4 · LXL04_018132 · OH-1004

Cell membrane0.078

Rank 5 · LXL04_018132 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XFS9`	Arabidopsis thaliana	1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic	60.000%	Swiss-Prot	weak database homology
`Q8W250`	Oryza sativa subsp. japonica	1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic	62.500%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card