LXL04_018048 | RubberDandelionOmics

Gene overview

LXL04_018048

Reference: OH-1004 Chr: Chr04 Coordinates: 5629784-5630804 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

927 bp · LXL04_018048|LXL04_018048|OH1004|cDNA

ATGGCTCCTTCTTCGGTTGCAGTATACTCCGAAACAGACGTATTCGCCATCGGAAAGCATGAAACAAAGCTTGTGAAACCAGAAGAATCCGTCACTCCAAAACCTCTGTTGATATTTACACCATTAGAAGCAGGGGAATACCCTGTACTGGTTTTACTCCATGGTTATCTTCTCTATAACTCCTTTTATTCCCAACTCAGCCATCACATCGCCTCCCATGGCTTCATCCTCGTCGTTCCCCAGTTATATTGTGTGACAGG...

CDS

Download CDS FASTA

927 bp · LXL04_018048|LXL04_018048|OH1004|CDS

ATGGCTCCTTCTTCGGTTGCAGTATACTCCGAAACAGACGTATTCGCCATCGGAAAGCATGAAACAAAGCTTGTGAAACCAGAAGAATCCGTCACTCCAAAACCTCTGTTGATATTTACACCATTAGAAGCAGGGGAATACCCTGTACTGGTTTTACTCCATGGTTATCTTCTCTATAACTCCTTTTATTCCCAACTCAGCCATCACATCGCCTCCCATGGCTTCATCCTCGTCGTTCCCCAGTTATATTGTGTGACAGG...

Protein

Download Protein FASTA

308 aa · LXL04_018048|LXL04_018048|OH1004|PROTEIN

MAPSSVAVYSETDVFAIGKHETKLVKPEESVTPKPLLIFTPLEAGEYPVLVLLHGYLLYNSFYSQLSHHIASHGFILVVPQLYCVTGPDATEEVECVAEIANWLPEELNKILPSQVSANLTNLGLAGHSRGGKVAFALALNRVNTKLKPKLKFSALIGIDPVDGMDTGKQTQPKVLSYVPGSFNLEMPVMVIGSGLGEVRKNLLFPACAPKGVNHEDFYNECCKPACYFVVKDYGHLDMLDDETNGIRGKATHCLCKNGK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018048`
TK1151 ID	TkA08G031330
OH-1004 ID	LXL04_018048
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	98.000
Protein coverage (%)	TK1151 83.193 / OH-1004 32.143 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018048

Location Chr04:5629784-5630804 (+)

Description Similar to CLH2: Chlorophyllase-2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g43860`	Catalyzes the hydrolysis of ester bond in chlorophyll to yield chlorophyllide and phytol.	Cloning of chlorophyllase, the key enzyme in chlorophyll degradation: finding of a lipase motif and the induction by methyl jasmonate.1999 · DOI: 10.1073/pnas.96.26.15362 The chlorophyllases AtCLH1 and AtCLH2 are not essential for senescence-related chlorophyll breakdown in Arabidopsis thaliana.2007 · DOI: 10.1016/j.febslet.2007.10.060 Repression of AtCLH1 expression results in a decrease in the ratio of chlorophyll a/b but doesnot affect the rate of chlorophyll degradation during leaf senescence.2007 · PMID: 18349515 Subcellular localization of chlorophyllase2 reveals it is not involved in chlorophyll degradation during senescence in Arabidopsis thaliana.2020 · DOI: 10.1016/j.plantsci.2019.110314
`At1g19670`	Catalyzes the hydrolysis of ester bond in chlorophyll to yield chlorophyllide and phytol.	Cloning of chlorophyllase, the key enzyme in chlorophyll degradation: finding of a lipase motif and the induction by methyl jasmonate.1999 · DOI: 10.1073/pnas.96.26.15362 Altering the expression of the chlorophyllase gene ATHCOR1 in transgenic Arabidopsis caused changes in the chlorophyll-to-chlorophyllide ratio.2002 · DOI: 10.1104/pp.010813 Chlorophyllase 1, a damage control enzyme, affects the balance between defense pathways in plants.2005 · DOI: 10.1105/tpc.104.025817 The chlorophyllases AtCLH1 and AtCLH2 are not essential for senescence-related chlorophyll breakdown in Arabidopsis thaliana.2007 · DOI: 10.1016/j.febslet.2007.10.060 Repression of AtCLH1 expression results in a decrease in the ratio of chlorophyll a/b but doesnot affect the rate of chlorophyll degradation during leaf senescence.2007 · PMID: 18349515 Subcellular localization of chlorophyllase2 reveals it is not involved in chlorophyll degradation during senescence in Arabidopsis thaliana.2020 · DOI: 10.1016/j.plantsci.2019.110314

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018048 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0015996 chlorophyll catabolic process Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0047746 chlorophyllase activity Molecular Function

KEGG gene cross-reference

ag:AAF27045

ath:AT1G19670

ath:AT5G43860

cit:102578008

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.371

Rank 1 · LXL04_018048 · OH-1004

Endoplasmic reticulum0.196

Rank 2 · LXL04_018048 · OH-1004

Cytoplasm0.187

Rank 3 · LXL04_018048 · OH-1004

Extracellular0.186

Rank 4 · LXL04_018048 · OH-1004

Cell membrane0.122

Rank 5 · LXL04_018048 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07224.18Chlorophyllase11-306 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018048	`PF07224.18`	Chlorophyllase	11	306	4.1e-130	433.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M7I7`	Arabidopsis thaliana	Chlorophyllase-2	54.747%	Swiss-Prot	strong database homology
`O22527`	Arabidopsis thaliana	Chlorophyllase-1	47.445%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card