LXL04_017898 | RubberDandelionOmics

Gene overview

LXL04_017898

Reference: OH-1004 Chr: Chr04 Coordinates: 3128226-3130597 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1737 bp · LXL04_017898|LXL04_017898|OH1004|cDNA

ATGCATTCATTTGAGGTATTCGGTTGTTTCATGAGGCAATTCAGGCCAAAAGAGGATGCACTTCCACATGATATTAAACAAGTGATTTCAAACTACTCGGACAATGGTGTAATGAGTGTTCAAAATCTTCAAGATTTCTTGACAAAATACCAAGGACAAACTGATTATGATGTCAATGCCATTTTCAATAAAGCAAAACATCACAATCTTCACCACAAAGGCCTACATGTCTTGCAATATCTATATAGCGACTTTAACTA...

CDS

Download CDS FASTA

1737 bp · LXL04_017898|LXL04_017898|OH1004|CDS

ATGCATTCATTTGAGGTATTCGGTTGTTTCATGAGGCAATTCAGGCCAAAAGAGGATGCACTTCCACATGATATTAAACAAGTGATTTCAAACTACTCGGACAATGGTGTAATGAGTGTTCAAAATCTTCAAGATTTCTTGACAAAATACCAAGGACAAACTGATTATGATGTCAATGCCATTTTCAATAAAGCAAAACATCACAATCTTCACCACAAAGGCCTACATGTCTTGCAATATCTATATAGCGACTTTAACTA...

Protein

Download Protein FASTA

578 aa · LXL04_017898|LXL04_017898|OH1004|PROTEIN

MHSFEVFGCFMRQFRPKEDALPHDIKQVISNYSDNGVMSVQNLQDFLTKYQGQTDYDVNAIFNKAKHHNLHHKGLHVLQYLYSDFNYPLQAVLDDMESPLSHYYIYTSHNTYLTGNQFTSDSSVRPIIRALQKGVRGIELDLWPNSTNSDILVCHGRTLTSSVKLRKCLKVIKDYAFHASEYPVIITFEDHLNKKLRDKVALVCKITFLDNLFRFFSRYSKKLKLMVKSTFQEMLLLPKKDRKLTKLPSPAELKKKIIIS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017898`
TK1151 ID	TkA08G042160
OH-1004 ID	LXL04_017898
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 51.211 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017898

Location Chr04:3128226-3130597 (+)

Description Similar to PLC2: Phosphoinositide phospholipase C 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g08510`	The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes.	N-terminal EF-hand-like domain is required for phosphoinositide-specific phospholipase C activity in Arabidopsis thaliana.2001 · DOI: 10.1016/s0014-5793(01)02453-x
`At3g55940`	The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes.	No verified direct reference in this release
`At2g40116`	The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes.	No verified direct reference in this release
`At5g58670`	The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes.	Arabidopsis PLC1 is required for secondary responses to abscisic acid signals.2001 · DOI: 10.1105/tpc.13.5.1143 A gene encoding a phosphatidylinositol-specific phospholipase C is induced by dehydration and salt stress in Arabidopsis thaliana.1995 · DOI: 10.1073/pnas.92.9.3903
`At4g38530`	The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017898 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006950 response to stress Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009556 microsporogenesis Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0010601 positive regulation of auxin biosynthetic process Biological Process

GO:0016042 lipid catabolic process Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0048015 phosphatidylinositol-mediated signaling Biological Process

KEGG gene cross-reference

ath:AT2G40116

ath:AT3G08510

ath:AT3G55940

ath:AT4G38530

ath:AT5G58670

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.433

Rank 1 · LXL04_017898 · OH-1004

Cell membrane0.287

Rank 2 · LXL04_017898 · OH-1004

Nucleus0.204

Rank 3 · LXL04_017898 · OH-1004

Endoplasmic reticulum0.139

Rank 4 · LXL04_017898 · OH-1004

Mitochondrion0.098

Rank 5 · LXL04_017898 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00388.26PI-PLC-X96-214 aa

PF00388.26PI-PLC-X221-262 aa

PF00387.26PI-PLC-Y336-430 aa

PF00168.37C2447-547 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017898	`PF00388.26`	PI-PLC-X	96	214	1.3e-52	178.0
LXL04_017898	`PF00388.26`	PI-PLC-X	221	262	1.3e-52	178.0
LXL04_017898	`PF00387.26`	PI-PLC-Y	336	430	3.6e-29	102.0
LXL04_017898	`PF00168.37`	C2	447	547	1.7e-11	45.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39033`	Arabidopsis thaliana	Phosphoinositide phospholipase C 2	47.411%	Swiss-Prot	moderate database homology
`Q9LY51`	Arabidopsis thaliana	Phosphoinositide phospholipase C 7	47.204%	Swiss-Prot	moderate database homology
`Q8GV43`	Arabidopsis thaliana	Phosphoinositide phospholipase C 6	53.065%	Swiss-Prot	strong database homology
`Q39032`	Arabidopsis thaliana	Phosphoinositide phospholipase C 1	46.769%	Swiss-Prot	moderate database homology
`Q56W08`	Arabidopsis thaliana	Phosphoinositide phospholipase C 3	47.643%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card