LXL04_017891 | RubberDandelionOmics

Gene overview

LXL04_017891

Reference: OH-1004 Chr: Chr04 Coordinates: 2940635-2943129 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

849 bp · LXL04_017891|LXL04_017891|OH1004|cDNA

ATGGAACCGGACAACCCTACCAAATATGAGACAAGAGTTAAAGAATTTGGGTTGAAGTCCATGTGGAGGAGTCCCAATGGCACAATCAGGAATATTTTTGATGGGACGATTTTTCGTGAGCCAATTATGTGCAAAGATGTTCCTAGAATAGTCCCAGTTGCCACCACAACTGGTCAAGATAGCTGGAAGTTTGCTTCTGCTCTTATGGGCATTTATATAAGAGGATCTATAAATTATATTGCGGTTTCAGAAGCACTTGG...

CDS

Download CDS FASTA

849 bp · LXL04_017891|LXL04_017891|OH1004|CDS

ATGGAACCGGACAACCCTACCAAATATGAGACAAGAGTTAAAGAATTTGGGTTGAAGTCCATGTGGAGGAGTCCCAATGGCACAATCAGGAATATTTTTGATGGGACGATTTTTCGTGAGCCAATTATGTGCAAAGATGTTCCTAGAATAGTCCCAGTTGCCACCACAACTGGTCAAGATAGCTGGAAGTTTGCTTCTGCTCTTATGGGCATTTATATAAGAGGATCTATAAATTATATTGCGGTTTCAGAAGCACTTGG...

Protein

Download Protein FASTA

282 aa · LXL04_017891|LXL04_017891|OH1004|PROTEIN

MEPDNPTKYETRVKEFGLKSMWRSPNGTIRNIFDGTIFREPIMCKDVPRIVPVATTTGQDSWKFASALMGIYIRGSINYIAVSEALGVSPSVVAARLNFNVMFVSEKLVIGVGYDCNPMVFTRVMCLGLMNKYQLELEPQLEALVGRHSRKPWSKFMNTDNQHLVSPEAIDFLNKLLCYDNQDRLTTKEAMGHPYFMQVRAAENNRMRTQYKFCETIQAKINFRWCGKNENSVSRRKLRGKSLGTSFPRGVFLGDHFRGK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017891`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017891

Location Chr04:2940635-2943129 (-)

Description Similar to CKA1: Casein kinase II subunit alpha-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g67380`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	Cloning and characterization of two cDNAs encoding casein kinase II catalytic subunits in Arabidopsis thaliana.1993 · DOI: 10.1007/bf00019944 Reconstitution of Arabidopsis casein kinase II from recombinant subunits and phosphorylation of transcription factor GBF1.1995 · DOI: 10.1105/tpc.7.1.105
`At3g50000`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates (By similarity).	No verified direct reference in this release
`At2g23080`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B6F107`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	No verified direct reference in this release
`UniProt: Q9AR27`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017891 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0006325 chromatin organization Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0006974 DNA damage response Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009648 photoperiodism Biological Process

GO:0009908 flower development Biological Process

GO:0010225 response to UV-C Biological Process

GO:0010229 inflorescence development Biological Process

GO:0010332 response to gamma radiation Biological Process

GO:0042752 regulation of circadian rhythm Biological Process

GO:0051726 regulation of cell cycle Biological Process

KEGG gene cross-reference

ath:AT2G23080

ath:AT3G50000

ath:AT5G67380

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.392

Rank 1 · LXL04_017891 · OH-1004

Nucleus0.303

Rank 2 · LXL04_017891 · OH-1004

Mitochondrion0.181

Rank 3 · LXL04_017891 · OH-1004

Cell membrane0.104

Rank 4 · LXL04_017891 · OH-1004

Endoplasmic reticulum0.074

Rank 5 · LXL04_017891 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05684.18DUF81957-103 aa

PF00069.32Pkinase157-196 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017891	`PF05684.18`	DUF819	57	103	5.4e-09	36.3
LXL04_017891	`PF00069.32`	Pkinase	157	196	9.1e-06	26.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q08467`	Arabidopsis thaliana	Casein kinase II subunit alpha-1	80.723%	Swiss-Prot	weak database homology
`Q08466`	Arabidopsis thaliana	Casein kinase II subunit alpha-2	79.518%	Swiss-Prot	weak database homology
`O64817`	Arabidopsis thaliana	Casein kinase II subunit alpha-3	77.778%	Swiss-Prot	weak database homology
`B6F107`	Oryza sativa subsp. japonica	Casein kinase II subunit alpha-2	77.108%	Swiss-Prot	weak database homology
`Q9AR27`	Oryza sativa subsp. indica	Casein kinase II subunit alpha-2	77.108%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card