Gene Card
Gene overview
cDNA / CDS / Protein Sequences
234 bp · LXL04_017761|LXL04_017761|OH1004|cDNA
ATGAGGAAGTTCGATCCATGGCCCGTTTTCTTCAAGAGGGAGTTCAACCGTAACTGGCCGTTCCTCGTTGGATTCGCCATAACCGGAAGCATAATCACCAAGCTTTCCCTCGGCCTTACTGAGGAAGACAGGAAGAAATCAGTTTTCGCCCAACGTCACAAGAGGTACGACACGACACCTCTAATCCGACCTAGTTTTATTCAGCTTTGGTAGCTCTAGATTTGAATATTTGCT
213 bp · LXL04_017761|LXL04_017761|OH1004|CDS
ATGAGGAAGTTCGATCCATGGCCCGTTTTCTTCAAGAGGGAGTTCAACCGTAACTGGCCGTTCCTCGTTGGATTCGCCATAACCGGAAGCATAATCACCAAGCTTTCCCTCGGCCTTACTGAGGAAGACAGGAAGAAATCAGTTTTCGCCCAACGTCACAAGAGGTACGACACGACACCTCTAATCCGACCTAGTTTTATTCAGCTTTGGTAG
Protein
Download Protein FASTA70 aa · LXL04_017761|LXL04_017761|OH1004|PROTEIN
MRKFDPWPVFFKREFNRNWPFLVGFAITGSIITKLSLGLTEEDRKKSVFAQRHKRYDTTPLIRPSFIQLW
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_017761 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_017761 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:878055-878394 (+) | |||||||||
| Description | Protein of unknown function | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006950 response to stress Biological Process GO:0006979 response to oxidative stress Biological Process GO:0009409 response to cold Biological Process GO:0009414 response to water deprivation Biological Process GO:0009744 response to sucrose Biological Process GO:0010555 response to mannitol Biological Process GO:0042542 response to hydrogen peroxide Biological Process GO:1902074 response to salt Biological Process GO:1902600 proton transmembrane transport Biological Process GO:0005739 mitochondrion Cellular Component GO:0005743 mitochondrial inner membrane Cellular Component GO:0005829 cytosol Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT3G46430 ath:AT5G59613 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF30978.1ATP_synth_61-52 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_017761 | PF30978.1 | ATP_synth_6 | 1 | 52 | 2.7e-33 | 114.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.