LXL04_017716 | RubberDandelionOmics

Gene overview

LXL04_017716

Reference: OH-1004 Chr: Chr04 Coordinates: 269229-269969 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

562 bp · LXL04_017716|LXL04_017716|OH1004|cDNA

ATGAGAAATATTCTTCTTCGGCTTCTTTGTCTGTTCAACTGCTTACATTCTTGTCTCCAACCCATCGATGTCATCAAGACCCGTTTACAACTTGACCGCGCCGGTCACTACAAGGGCATTCTCCATTGCGGCAACACCACCGTCACAAACGAAGGCGTCCGTGCTCTTTGGAAGGGTTTGACGCCCTTCGCCACTCACCTGACATTGAAATATGCCCTCCGGATGGGCTCCAATGCCGTGATTCAATCGGCGTTTAAAGA...

CDS

Download CDS FASTA

525 bp · LXL04_017716|LXL04_017716|OH1004|CDS

ATGAGAAATATTCTTCTTCGGCTTCTTTGTCTGTTCAACTGCTTACATTCTTGTCTCCAACCCATCGATGTCATCAAGACCCGTTTACAACTTGACCGCGCCGGTCACTACAAGGGCATTCTCCATTGCGGCAACACCACCGTCACAAACGAAGGCGTCCGTGCTCTTTGGAAGGGTTTGACGCCCTTCGCCACTCACCTGACATTGAAATATGCCCTCCGGATGGGCTCCAATGCCGTGATTCAATCGGCGTTTAAAGA...

Protein

Download Protein FASTA

174 aa · LXL04_017716|LXL04_017716|OH1004|PROTEIN

MRNILLRLLCLFNCLHSCLQPIDVIKTRLQLDRAGHYKGILHCGNTTVTNEGVRALWKGLTPFATHLTLKYALRMGSNAVIQSAFKDANTGKISDGGRFVSGFGAGVIEALVILTPFEVVKIRLQQQKGLAQDLLNLPPLDFEAHNTSLVSGAGTSGVQEAISMAEKQSSSLVQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017716`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017716

Location Chr04:269229-269969 (+)

Description Similar to SFC1: Mitochondrial succinate-fumarate transporter 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g01340`	May transport cytoplasmic succinate, derived from fatty acid oxidation, into the mitochondrial matrix in exchange of fumarate during lipid mobilization in seed germination.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017716 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006843 mitochondrial citrate transmembrane transport Biological Process

GO:0007528 neuromuscular junction development Biological Process

GO:0010821 regulation of mitochondrion organization Biological Process

GO:0015741 fumarate transport Biological Process

GO:0015742 alpha-ketoglutarate transport Biological Process

GO:0015743 malate transport Biological Process

GO:0015744 succinate transport Biological Process

GO:0015746 citrate transport Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0031966 mitochondrial membrane Cellular Component

GO:0005469 succinate:fumarate antiporter activity Molecular Function

KEGG gene cross-reference

ath:AT5G01340

dre:393579

sce:YJR095W

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.918

Rank 1 · LXL04_017716 · OH-1004

Cytoplasm0.048

Rank 2 · LXL04_017716 · OH-1004

Nucleus0.031

Rank 3 · LXL04_017716 · OH-1004

Cell membrane0.019

Rank 4 · LXL04_017716 · OH-1004

Plastid0.015

Rank 5 · LXL04_017716 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00153.33Mito_carr16-86 aa

PF00153.33Mito_carr97-132 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017716	`PF00153.33`	Mito_carr	16	86	3.5e-21	75.5
LXL04_017716	`PF00153.33`	Mito_carr	97	132	3.5e-21	75.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M038`	Arabidopsis thaliana	Mitochondrial succinate-fumarate transporter 1	78.151%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card