LXL04_017684 | RubberDandelionOmics

Gene overview

LXL04_017684

Reference: OH-1004 Chr: Chr03 Coordinates: 156874288-156876503 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1110 bp · LXL04_017684|LXL04_017684|OH1004|cDNA

ATGGAGGTCACAAATGTCACCGAGTATCAAGCGATTGCCAAAGAGAAGTTGCCAAAGATGGTGTACGACTACTATGCTTCAGGTGCTGAGGATCAGTGGACTTTGGAAGAGAACAGAAATGCTTTCGCAAGAATCCTGTTTAGGCCTCGGATTCTTATTGATGTGAGCAAGATTGACATGACTACCACAATTTTGGGATTCAAGATCTCCATGCCAATAATGATCGCCCCAACTGCCATGCAGAAGATGGCACACCCTGA...

CDS

Download CDS FASTA

1110 bp · LXL04_017684|LXL04_017684|OH1004|CDS

ATGGAGGTCACAAATGTCACCGAGTATCAAGCGATTGCCAAAGAGAAGTTGCCAAAGATGGTGTACGACTACTATGCTTCAGGTGCTGAGGATCAGTGGACTTTGGAAGAGAACAGAAATGCTTTCGCAAGAATCCTGTTTAGGCCTCGGATTCTTATTGATGTGAGCAAGATTGACATGACTACCACAATTTTGGGATTCAAGATCTCCATGCCAATAATGATCGCCCCAACTGCCATGCAGAAGATGGCACACCCTGA...

Protein

Download Protein FASTA

369 aa · LXL04_017684|LXL04_017684|OH1004|PROTEIN

MEVTNVTEYQAIAKEKLPKMVYDYYASGAEDQWTLEENRNAFARILFRPRILIDVSKIDMTTTILGFKISMPIMIAPTAMQKMAHPDGEYATARAASSAGTIMTLSSWATSSVEEVASTGPGIRFFQLYVYKDRNVVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFTLPPFLTLKNFEGLDLGKMDEANDSGLASYVAGQIDRTLSWKDVKWLQTITTMPILVKGVITAEDTRLAIQAGAAGIIVSNHGARQLD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017684`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017684

Location Chr03:156874288-156876503 (+)

Description Similar to GLO1: (S)-2-hydroxy-acid oxidase GLO1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g14420`	Catalyzes the oxidation of glycolate to glyoxylate, with a reduction of O2 to H2O2.	No verified direct reference in this release
`At3g14415`	Catalyzes the oxidation of glycolate to glyoxylate, with a reduction of O2 to H2O2.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0152900`	Catalyzes the oxidation of glycolate to glyoxylate, with a reduction of O2 to H2O2.	No verified direct reference in this release
`UniProt: B8B7C5`	Catalyzes the oxidation of glycolate to glyoxylate, with a reduction of O2 to H2O2.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017684 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009853 photorespiration Biological Process

GO:0009854 oxidative photosynthetic carbon pathway Biological Process

GO:0010109 regulation of photosynthesis Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0046718 symbiont entry into host cell Biological Process

GO:0050665 hydrogen peroxide biosynthetic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT3G14415

ath:AT3G14420

dosa:Os07g0152900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Peroxisome0.561

Rank 1 · LXL04_017684 · OH-1004

Mitochondrion0.244

Rank 2 · LXL04_017684 · OH-1004

Cytoplasm0.130

Rank 3 · LXL04_017684 · OH-1004

Plastid0.070

Rank 4 · LXL04_017684 · OH-1004

Nucleus0.041

Rank 5 · LXL04_017684 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01070.25FMN_dh13-355 aa

PF00478.32IMPDH264-311 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017684	`PF01070.25`	FMN_dh	13	355	2.9e-138	461.4
LXL04_017684	`PF00478.32`	IMPDH	264	311	7e-06	26.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LRR9`	Arabidopsis thaliana	Glycolate oxidase 1	91.057%	Swiss-Prot	strong database homology
`Q9LRS0`	Arabidopsis thaliana	Glycolate oxidase 2	90.411%	Swiss-Prot	strong database homology
`Q6YT73`	Oryza sativa subsp. japonica	Glycolate oxidase 5	88.493%	Swiss-Prot	strong database homology
`B8B7C5`	Oryza sativa subsp. indica	Glycolate oxidase 5	88.493%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card