LXL04_017665 | RubberDandelionOmics

Gene overview

LXL04_017665

Reference: OH-1004 Chr: Chr03 Coordinates: 156285092-156287841 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1971 bp · LXL04_017665|LXL04_017665|OH1004|cDNA

ATGATGCATCTCATAAATAAGTTTGAACACCTGAAGATACACTTGGAAGCTTTAAAATCAGCAACAAACAACTTTTCTGCTGAAAATTGTATCGGTAGAGGAGGTTTTGGAAAAGTATACAAGGGAGAGCTTGTTCATTCCAAAGAGAAAGTAGTTGTTGCTCTAAAGCGATTAGACCCAAGATTTGGGCAAGGAAATCCGGAGTTTTGGATGGAGATTCTTATGCTTTCTCTTCACAAACACGAAAACATTATTTCTCT...

CDS

Download CDS FASTA

1971 bp · LXL04_017665|LXL04_017665|OH1004|CDS

ATGATGCATCTCATAAATAAGTTTGAACACCTGAAGATACACTTGGAAGCTTTAAAATCAGCAACAAACAACTTTTCTGCTGAAAATTGTATCGGTAGAGGAGGTTTTGGAAAAGTATACAAGGGAGAGCTTGTTCATTCCAAAGAGAAAGTAGTTGTTGCTCTAAAGCGATTAGACCCAAGATTTGGGCAAGGAAATCCGGAGTTTTGGATGGAGATTCTTATGCTTTCTCTTCACAAACACGAAAACATTATTTCTCT...

Protein

Download Protein FASTA

656 aa · LXL04_017665|LXL04_017665|OH1004|PROTEIN

MMHLINKFEHLKIHLEALKSATNNFSAENCIGRGGFGKVYKGELVHSKEKVVVALKRLDPRFGQGNPEFWMEILMLSLHKHENIISLLGFCDENNEKILVYEYASRRSLDAYLDHDDLTWIRRLKICIGAARGIAYLHNPGETQQRVLHRDIKSSNILLDENWNAKIADLGLSKFGPANQRYTFLVTNTVGTLGYCDPVYIETGLLTKESDVYSFGVVLFEVLCGRLSISNNNGSTESLIGLVRQYYPQNKISDIIYSNM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017665`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017665

Location Chr03:156285092-156287841 (-)

Description Similar to PTI1: Pto-interacting protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g48210`	Receptor-like cytoplasmic kinase (RLCK) that triggers abscisic acid (ABA) signaling in response to dehydration by phosphorylating and activating ABA receptors (e.g. PYR1/RCAR11, PYL1/RCAR12, PYL3/RCAR13 and PYL2/RCAR14) to support their monomerization and enhance their ABA binding affinity; they in turn repress PP2C protein phosphatases acting as negative regulators of ABA responses.	No verified direct reference in this release
`At3g17410`	May phosphorylate ABA receptors and participate in ABA signaling during dehydration.	CARK1 mediates ABA signaling by phosphorylation of ABA receptors.2018 · DOI: 10.1038/s41421-018-0029-y The Expression of CARK1 or RCAR11 Driven by Synthetic Promoters Increases Drought Tolerance in Arabidopsis thaliana .2018 · DOI: 10.3390/ijms19071945 Monomerization of abscisic acid receptors through CARKs-mediated phosphorylation.2022 · DOI: 10.1111/nph.18149
`At1g48220`	Receptor-like cytoplasmic kinase (RLCK) that triggers abscisic acid (ABA) signaling in response to dehydration by phosphorylating and activating ABA receptors to support their monomerization and enhance their ABA binding affinity; they in turn repress PP2C protein phosphatases acting as negative regulators of ABA responses.	No verified direct reference in this release
`At2g47060`	Receptor-like cytoplasmic kinase (RLCK) that triggers abscisic acid (ABA) signaling in response to dehydration by phosphorylating and activating ABA receptors to support their monomerization and enhance their ABA binding affinity; they in turn repress PP2C protein phosphatases acting as negative regulators of ABA responses (Probable).	The Arabidopsis protein kinase Pto-interacting 1-4 is a common target of the oxidative signal-inducible 1 and mitogen-activated protein kinases.2011 · DOI: 10.1111/j.1742-4658.2011.08033.x Monomerization of abscisic acid receptors through CARKs-mediated phosphorylation.2022 · DOI: 10.1111/nph.18149

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017665 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:1902584 positive regulation of response to water deprivation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0000287 magnesium ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G48210

ath:AT3G17410

sly:544006

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.563

Rank 1 · LXL04_017665 · OH-1004

Cytoplasm0.353

Rank 2 · LXL04_017665 · OH-1004

Nucleus0.230

Rank 3 · LXL04_017665 · OH-1004

Endoplasmic reticulum0.041

Rank 4 · LXL04_017665 · OH-1004

Golgi apparatus0.036

Rank 5 · LXL04_017665 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase27-294 aa

PF07714.24PK_Tyr_Ser-Thr28-296 aa

PF00069.32Pkinase371-646 aa

PF07714.24PK_Tyr_Ser-Thr374-648 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017665	`PF00069.32`	Pkinase	27	294	1.2e-79	268.1
LXL04_017665	`PF07714.24`	PK_Tyr_Ser-Thr	28	296	9e-87	291.3
LXL04_017665	`PF00069.32`	Pkinase	371	646	1.2e-79	268.1
LXL04_017665	`PF07714.24`	PK_Tyr_Ser-Thr	374	648	9e-87	291.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HWU0`	Arabidopsis thaliana	Protein CYTOSOLIC ABA RECEPTOR KINASE 11	62.092%	Swiss-Prot	weak database homology
`Q9LUT0`	Arabidopsis thaliana	Protein CYTOSOLIC ABA RECEPTOR KINASE 1	62.745%	Swiss-Prot	weak database homology
`Q9SX57`	Arabidopsis thaliana	Protein CYTOSOLIC ABA RECEPTOR KINASE 10	57.605%	Swiss-Prot	weak database homology
`O80719`	Arabidopsis thaliana	Protein CYTOSOLIC ABA RECEPTOR KINASE 3	61.765%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card