LXL04_017623 | RubberDandelionOmics

Gene overview

LXL04_017623

Reference: OH-1004 Chr: Chr03 Coordinates: 155427763-155430597 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

846 bp · LXL04_017623|LXL04_017623|OH1004|cDNA

ATGACCTACTCATCGCAATCGATTCCTTCTGCATCTCTGAAAGTCGCCAGTCGCCTCACTCCCCTCCTGTTGCTCCTTGCCGTCTCCCTTTTCTGTGACGCCGGCGATCGCTCCACCGGAAAAGCGAACCTCAGTCGGCGGTCTTCCTATCGCCGTCTGATCTGCTTGCTGTTTCCCTCTTCAGTCTCCGAATCTTCCTTTTCTGTCGCCATCTGCTCCAAGAGAGATGTTTTGGAACTCGAAGAGGCCATTAAAATCAA...

CDS

Download CDS FASTA

846 bp · LXL04_017623|LXL04_017623|OH1004|CDS

ATGACCTACTCATCGCAATCGATTCCTTCTGCATCTCTGAAAGTCGCCAGTCGCCTCACTCCCCTCCTGTTGCTCCTTGCCGTCTCCCTTTTCTGTGACGCCGGCGATCGCTCCACCGGAAAAGCGAACCTCAGTCGGCGGTCTTCCTATCGCCGTCTGATCTGCTTGCTGTTTCCCTCTTCAGTCTCCGAATCTTCCTTTTCTGTCGCCATCTGCTCCAAGAGAGATGTTTTGGAACTCGAAGAGGCCATTAAAATCAA...

Protein

Download Protein FASTA

281 aa · LXL04_017623|LXL04_017623|OH1004|PROTEIN

MTYSSQSIPSASLKVASRLTPLLLLLAVSLFCDAGDRSTGKANLSRRSSYRRLICLLFPSSVSESSFSVAICSKRDVLELEEAIKIKDGEAESYISEIETIGQAYEDMQTQNQHLLQQVMERDDYNIKLVSESVKMKQTHTALISEKQILDKQLQQVNSAFESLKSRIAHSEEQMNACVTQALKMDRKKLDEELVELNMKVTELTLGSSEAAIQKLQDEIKECKSILKCRVCFDRPKEVVIVKCYHLFCNPCIQRNLEIR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017623`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017623

Location Chr03:155427763-155430597 (+)

Description Similar to HUB2: E3 ubiquitin-protein ligase BRE1-like 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q9C895`	E3 ubiquitin-protein ligase that monoubiquitinates H2B to form H2BK143ub1.	No verified direct reference in this release
`UniProt: Q8RXD6`	E3 ubiquitin-protein ligase that monoubiquitinates H2B to form H2BK143ub1.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0565600`	E3 ubiquitin-protein ligase that monoubiquitinates H2B to form H2BK143ub1.	Histone H2B Monoubiquitination Mediated by HISTONE MONOUBIQUITINATION1 and HISTONE MONOUBIQUITINATION2 Is Involved in Anther Development by Regulating Tapetum Degradation-Related Genes in Rice.2015 · DOI: 10.1104/pp.114.256578 Flowering-Related RING Protein 1 (FRRP1) Regulates Flowering Time and Yield Potential by Affecting Histone H2B Monoubiquitination in Rice (Oryza Sativa).2016 · DOI: 10.1371/journal.pone.0150458
`UniProt: A2ZAC2`	E3 ubiquitin-protein ligase that monoubiquitinates H2B to form H2BK143ub1.	No verified direct reference in this release
`UniProt: A2XW69`	E3 ubiquitin-protein ligase that monoubiquitinates H2B to form H2BK143ub1.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017623 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006325 chromatin organization Biological Process

GO:0006513 protein monoubiquitination Biological Process

GO:0009908 flower development Biological Process

GO:0009965 leaf morphogenesis Biological Process

GO:0010162 seed dormancy process Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0010389 regulation of G2/M transition of mitotic cell cycle Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0045087 innate immune response Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0051301 cell division Biological Process

GO:0051781 positive regulation of cell division Biological Process

KEGG gene cross-reference

ath:AT1G55250

ath:AT2G44950

dosa:Os10g0565600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.490

Rank 1 · LXL04_017623 · OH-1004

Cytoplasm0.462

Rank 2 · LXL04_017623 · OH-1004

Golgi apparatus0.063

Rank 3 · LXL04_017623 · OH-1004

Mitochondrion0.059

Rank 4 · LXL04_017623 · OH-1004

Endoplasmic reticulum0.046

Rank 5 · LXL04_017623 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13920.13zf-C3HC4_3227-269 aa

PF13923.13zf-C3HC4_2228-267 aa

PF00097.32zf-C3HC4229-267 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017623	`PF13920.13`	zf-C3HC4_3	227	269	1.3e-08	35.2
LXL04_017623	`PF13923.13`	zf-C3HC4_2	228	267	5.8e-08	33.1
LXL04_017623	`PF00097.32`	zf-C3HC4	229	267	7.5e-10	39.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C895`	Arabidopsis thaliana	E3 ubiquitin-protein ligase BRE1-like 2	52.434%	Swiss-Prot	strong database homology
`Q8RXD6`	Arabidopsis thaliana	E3 ubiquitin-protein ligase BRE1-like 1	37.079%	Swiss-Prot	moderate database homology
`Q336R3`	Oryza sativa subsp. japonica	E3 ubiquitin-protein ligase BRE1-like 2	51.866%	Swiss-Prot	strong database homology
`A2ZAC2`	Oryza sativa subsp. indica	E3 ubiquitin-protein ligase BRE1-like 2	51.866%	Swiss-Prot	strong database homology
`A2XW69`	Oryza sativa subsp. indica	E3 ubiquitin-protein ligase BRE1-like 1	32.342%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card