LXL04_017447 | RubberDandelionOmics

Gene overview

LXL04_017447

Reference: OH-1004 Chr: Chr03 Coordinates: 149510188-149512860 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1176 bp · LXL04_017447|LXL04_017447|OH1004|cDNA

ATGAGTTCGATGGCTGCTCTAAGTTCAATATTCATCCATGGAGGGTGCTTTTCTAGGTTTCAGGATGAATCCAAATCTCTAAAAATGAGGAAAATGGCCACAAGGTTCTCAGTGGTATCATCAGCTCAGAAATCAAATAAGTCCATTAAAGTTGGTATTCTTGGAGCTAGTGGTTATACTGGTGCAGAGCTTATTAGATTCCTTGCAAACCATCCTTACTTTGACATTTCACTAATGACTGCTGATAGAAAAGCCGGTCA...

CDS

Download CDS FASTA

1176 bp · LXL04_017447|LXL04_017447|OH1004|CDS

ATGAGTTCGATGGCTGCTCTAAGTTCAATATTCATCCATGGAGGGTGCTTTTCTAGGTTTCAGGATGAATCCAAATCTCTAAAAATGAGGAAAATGGCCACAAGGTTCTCAGTGGTATCATCAGCTCAGAAATCAAATAAGTCCATTAAAGTTGGTATTCTTGGAGCTAGTGGTTATACTGGTGCAGAGCTTATTAGATTCCTTGCAAACCATCCTTACTTTGACATTTCACTAATGACTGCTGATAGAAAAGCCGGTCA...

Protein

Download Protein FASTA

391 aa · LXL04_017447|LXL04_017447|OH1004|PROTEIN

MSSMAALSSIFIHGGCFSRFQDESKSLKMRKMATRFSVVSSAQKSNKSIKVGILGASGYTGAELIRFLANHPYFDISLMTADRKAGQSIGSVFPHLITQNLPDLVAVKDADFSSVDAVFCCLPHGTTQEIIKGLPSSLKIVDLSADFRLRDINDYAEWYGQPHKATELQKEAVYGLTEIYRNKIQNARLVANPGCYPTTVLLPLVPLMKANLITYENIVIVSNSGVSGAGRSAKEANLYTEISEGIFSYGITRHRHVPEI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017447`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017447

Location Chr03:149510188-149512860 (-)

Description Similar to At2g19940: Probable N-acetyl-gamma-glutamyl-phosphate reductase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g19940`	Probable N-acetyl-gamma-glutamyl-phosphate reductase, chloroplastic.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0617900`	Probable N-acetyl-gamma-glutamyl-phosphate reductase, chloroplastic.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017447 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006526 L-arginine biosynthetic process Biological Process

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0003942 N-acetyl-gamma-glutamyl-phosphate reductase activity Molecular Function

GO:0005507 copper ion binding Molecular Function

GO:0051287 NAD binding Molecular Function

GO:0070401 NADP+ binding Molecular Function

KEGG gene cross-reference

ath:AT2G19940

dosa:Os03g0617900

oca:OCAR_6010

ocg:OCA5_c20150

rcp:RCAP_rcc00553

rru:Rru_A2421

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.958

Rank 1 · LXL04_017447 · OH-1004

Mitochondrion0.083

Rank 2 · LXL04_017447 · OH-1004

Cytoplasm0.053

Rank 3 · LXL04_017447 · OH-1004

Peroxisome0.035

Rank 4 · LXL04_017447 · OH-1004

Nucleus0.019

Rank 5 · LXL04_017447 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01118.31Semialdhyde_dh50-187 aa

PF22698.2Semialdhyde_dhC_1195-359 aa

PF02774.24Semialdhyde_dhC204-362 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017447	`PF01118.31`	Semialdhyde_dh	50	187	2.9e-29	102.6
LXL04_017447	`PF22698.2`	Semialdhyde_dhC_1	195	359	8e-57	192.4
LXL04_017447	`PF02774.24`	Semialdhyde_dhC	204	362	5.7e-21	76.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93Z70`	Arabidopsis thaliana	Probable N-acetyl-gamma-glutamyl-phosphate reductase, chloroplastic	67.488%	Swiss-Prot	strong database homology
`Q6AV34`	Oryza sativa subsp. japonica	Probable N-acetyl-gamma-glutamyl-phosphate reductase, chloroplastic	72.727%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card