LXL04_017292 | RubberDandelionOmics

Gene overview

LXL04_017292

Reference: OH-1004 Chr: Chr03 Coordinates: 145132452-145136334 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2010 bp · LXL04_017292|LXL04_017292|OH1004|cDNA

ATGTCCATGATTCTCCGGGTCTTACCCGACATAGCAATTCGATCTAGACACCTTTCAACTCAATCCCTTGCTCTTTTTCGCGTTAATCACACAATTCTCAAACCCCTGATAACAAAATCATTCACTTCTGTGTGTGCTTCCACAACTGAACCAGTTGTAAGTAATCCCCCAACAAAGGAACAACGACGGCAATCTGTACCTGGTTCCATTCACGAAACCACCACTCTCGAATGGGTCAATCGAAATGGACTATGCGGCGA...

CDS

Download CDS FASTA

2010 bp · LXL04_017292|LXL04_017292|OH1004|CDS

ATGTCCATGATTCTCCGGGTCTTACCCGACATAGCAATTCGATCTAGACACCTTTCAACTCAATCCCTTGCTCTTTTTCGCGTTAATCACACAATTCTCAAACCCCTGATAACAAAATCATTCACTTCTGTGTGTGCTTCCACAACTGAACCAGTTGTAAGTAATCCCCCAACAAAGGAACAACGACGGCAATCTGTACCTGGTTCCATTCACGAAACCACCACTCTCGAATGGGTCAATCGAAATGGACTATGCGGCGA...

Protein

Download Protein FASTA

669 aa · LXL04_017292|LXL04_017292|OH1004|PROTEIN

MSMILRVLPDIAIRSRHLSTQSLALFRVNHTILKPLITKSFTSVCASTTEPVVSNPPTKEQRRQSVPGSIHETTTLEWVNRNGLCGELSENDVGRRVRLCGWVALHRGHGGLTFVNLRDHSGIVQVTTLPNEFPDAHSIVNDLRLEYVVAIEGVVRPRPSDSVNKNMKTGMIEVTAEQVQVLNSVRAKLPFLVTSAEDAKDSIKEEIRLRYRCLDLRRPQMNSNIMLRHQVVKLIRRYLEDVHGFVEIETPILSRSTPEG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017292`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017292

Location Chr03:145132452-145136334 (-)

Description Similar to At4g33760: Aspartate--tRNA ligase, chloroplastic/mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g33760`	Catalyzes the specific attachment of an amino acid to its cognate tRNA in a 2 step reaction: the amino acid (AA) is first activated by ATP to form AA-AMP and then transferred to the acceptor end of the tRNA.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017292 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006422 aspartyl-tRNA aminoacylation Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003676 nucleic acid binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0004815 aspartate-tRNA ligase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0050560 aspartate-tRNA(Asn) ligase activity Molecular Function

KEGG gene cross-reference

ana:all2436

ath:AT4G33760

ava:Ava_0247

npu:Npun_F3458

ter:Tery_2354

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.798

Rank 1 · LXL04_017292 · OH-1004

Cytoplasm0.097

Rank 2 · LXL04_017292 · OH-1004

Plastid0.089

Rank 3 · LXL04_017292 · OH-1004

Nucleus0.051

Rank 4 · LXL04_017292 · OH-1004

Peroxisome0.010

Rank 5 · LXL04_017292 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01336.32tRNA_anti-codon97-182 aa

PF00152.26tRNA-synt_2204-643 aa

PF02938.20GAD396-495 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017292	`PF01336.32`	tRNA_anti-codon	97	182	1.2e-13	51.4
LXL04_017292	`PF00152.26`	tRNA-synt_2	204	643	8.5e-121	403.5
LXL04_017292	`PF02938.20`	GAD	396	495	2.3e-17	63.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JJT9`	Arabidopsis thaliana	Aspartate--tRNA ligase, chloroplastic/mitochondrial	78.921%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card