LXL04_017280 | RubberDandelionOmics

Gene overview

LXL04_017280

Reference: OH-1004 Chr: Chr03 Coordinates: 145018252-145025190 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3447 bp · LXL04_017280|LXL04_017280|OH1004|cDNA

ATGGCGACCTACGCGTTGCTCAGATCTCTTCGTCGAAGAGATATCTCATCTGCTCCTTTATCCGCCTTCAAATCCTTAAGTGGAGCCAAACCATCATGGGCTGGATCACATTTAAGTCACAAGATAAGCATGCTTTCCAGACCCTTCAGCTCAAGACCTCTAGGAAACGAAGTTATTGGTATTGACTTAGGTACAACAAACTCATGTGTTGCAGTCATGGAAGGAAAGACTGCAAAGGTGATTGAGAATTCAGAAGGATC...

CDS

Download CDS FASTA

3447 bp · LXL04_017280|LXL04_017280|OH1004|CDS

ATGGCGACCTACGCGTTGCTCAGATCTCTTCGTCGAAGAGATATCTCATCTGCTCCTTTATCCGCCTTCAAATCCTTAAGTGGAGCCAAACCATCATGGGCTGGATCACATTTAAGTCACAAGATAAGCATGCTTTCCAGACCCTTCAGCTCAAGACCTCTAGGAAACGAAGTTATTGGTATTGACTTAGGTACAACAAACTCATGTGTTGCAGTCATGGAAGGAAAGACTGCAAAGGTGATTGAGAATTCAGAAGGATC...

Protein

Download Protein FASTA

1148 aa · LXL04_017280|LXL04_017280|OH1004|PROTEIN

MATYALLRSLRRRDISSAPLSAFKSLSGAKPSWAGSHLSHKISMLSRPFSSRPLGNEVIGIDLGTTNSCVAVMEGKTAKVIENSEGSRTTPSVVAFNQKGELIVGTPAKRQAVTNPTNTVFGTKRLIGRRFDDPQTQKEMQMVPYKIVKAPNGDAWVEANGQKYSPSQIGAFVLTKMKETAEAYLGKTINKAVITVPAYFNDAQRQATKDAGRIAGLDVERIINEPTAAALSYGLNNKEGLIAVFDLGGGTFDVSILEIS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017280`
TK1151 ID	TkA02G060410
OH-1004 ID	LXL04_017280
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.400
Protein coverage (%)	TK1151 100.000 / OH-1004 37.369 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017280

Location Chr03:145018252-145025190 (-)

Description Similar to Heat shock 70 kDa protein, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g09590`	Chaperone involved in the maturation of iron-sulfur [Fe-S] cluster-containing proteins.	No verified direct reference in this release
`At4g37910`	Chaperone involved in the maturation of iron-sulfur [Fe-S] cluster-containing proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017280 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0009408 response to heat Biological Process

GO:0009615 response to virus Biological Process

GO:0016226 iron-sulfur cluster assembly Biological Process

GO:0017004 cytochrome complex assembly Biological Process

GO:0042026 protein refolding Biological Process

GO:0140964 intracellular auxin homeostasis Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT4G37910

ath:AT5G09590

sot:102582209

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.707

Rank 1 · LXL04_017280 · OH-1004

Cytoplasm0.139

Rank 2 · LXL04_017280 · OH-1004

Peroxisome0.081

Rank 3 · LXL04_017280 · OH-1004

Nucleus0.076

Rank 4 · LXL04_017280 · OH-1004

Plastid0.068

Rank 5 · LXL04_017280 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00012.27HSP7058-650 aa

PF06723.20MreB_Mbl188-424 aa

PF14223.15Retrotran_gag_2674-830 aa

PF22936.2Pol_BBD942-1019 aa

PF13976.12gag_pre-integrs1058-1118 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017280	`PF00012.27`	HSP70	58	650	2.1e-272	905.5
LXL04_017280	`PF06723.20`	MreB_Mbl	188	424	5.8e-12	45.8
LXL04_017280	`PF14223.15`	Retrotran_gag_2	674	830	3.9e-30	105.5
LXL04_017280	`PF22936.2`	Pol_BBD	942	1019	2.8e-28	98.8
LXL04_017280	`PF13976.12`	gag_pre-integrs	1058	1118	1.5e-13	51.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LDZ0`	Arabidopsis thaliana	Heat shock 70 kDa protein 10, mitochondrial	82.181%	Swiss-Prot	moderate database homology
`Q8GUM2`	Arabidopsis thaliana	Heat shock 70 kDa protein 9, mitochondrial	82.335%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card