LXL04_017188 | RubberDandelionOmics

Gene overview

LXL04_017188

Reference: OH-1004 Chr: Chr03 Coordinates: 142944976-142949785 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

948 bp · LXL04_017188|LXL04_017188|OH1004|cDNA

ATGAGGGCTGGGTTACGGCCATTTCTGCGTTCCATTAAAGTTTCAATTCTTGGATCTTCCCCTGTTTACAAGTCCGAGTGTCCGAAATCGGCTGCTTCAACATCAACTATCTCTGGTTCCAAGCTGAAGTATTCGGGAATTGAGCAGACACAGTTGGGATTTCTGAATTCGTCCAAGAGCAATTTGGCTTTGAGATTGAAAGCCTTAAGGGAAGGGGTCGGTTTAGTTCAAGAAACTAAAGTTAATGTACCTAATCTTAT...

CDS

Download CDS FASTA

948 bp · LXL04_017188|LXL04_017188|OH1004|CDS

ATGAGGGCTGGGTTACGGCCATTTCTGCGTTCCATTAAAGTTTCAATTCTTGGATCTTCCCCTGTTTACAAGTCCGAGTGTCCGAAATCGGCTGCTTCAACATCAACTATCTCTGGTTCCAAGCTGAAGTATTCGGGAATTGAGCAGACACAGTTGGGATTTCTGAATTCGTCCAAGAGCAATTTGGCTTTGAGATTGAAAGCCTTAAGGGAAGGGGTCGGTTTAGTTCAAGAAACTAAAGTTAATGTACCTAATCTTAT...

Protein

Download Protein FASTA

315 aa · LXL04_017188|LXL04_017188|OH1004|PROTEIN

MRAGLRPFLRSIKVSILGSSPVYKSECPKSAASTSTISGSKLKYSGIEQTQLGFLNSSKSNLALRLKALREGVGLVQETKVNVPNLINKSMDGSDAFTEMKQRFLTFKKEKYLENLECYQELALAQAPKFLVISCADSRVCPSYILGFQPGEAFVVRNIANLVPPFENGPCETNAALEFSVNALQVENILVTGHSCCGGIRALMGMEDEENSSSFIKNWVKVGKSARSNTKSTTSNLTFDQQCKHCEKESINHSLMNLLT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017188`
TK1151 ID	TkA02G069260
OH-1004 ID	LXL04_017188
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017188

Location Chr03:142944976-142949785 (-)

Description Similar to BCA5: Beta carbonic anhydrase 5, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g33580`	Reversible hydration of carbon dioxide.	No verified direct reference in this release
`At1g58180`	Reversible hydration of carbon dioxide.	No verified direct reference in this release
`At1g70410`	Reversible hydration of carbon dioxide.	No verified direct reference in this release
`At3g01500`	Reversible hydration of carbon dioxide.	Reduction of plastid-localized carbonic anhydrase activity results in reduced Arabidopsis seedling survivorship.2008 · DOI: 10.1104/pp.108.118661 S-nitrosylation of AtSABP3 antagonizes the expression of plant immunity.2009 · DOI: 10.1074/jbc.m806782200
`At1g23730`	Reversible hydration of carbon dioxide.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017188 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009409 response to cold Biological Process

GO:0010037 response to carbon dioxide Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0015976 carbon utilization Biological Process

GO:0015979 photosynthesis Biological Process

GO:0050832 defense response to fungus Biological Process

GO:2000122 negative regulation of stomatal complex development Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G23730

ath:AT1G58180

ath:AT1G70410

ath:AT3G01500

ath:AT4G33580

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.666

Rank 1 · LXL04_017188 · OH-1004

Mitochondrion0.213

Rank 2 · LXL04_017188 · OH-1004

Cytoplasm0.136

Rank 3 · LXL04_017188 · OH-1004

Nucleus0.105

Rank 4 · LXL04_017188 · OH-1004

Cell membrane0.040

Rank 5 · LXL04_017188 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00484.25Pro_CA131-284 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017188	`PF00484.25`	Pro_CA	131	284	1.6e-42	146.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94CE3`	Arabidopsis thaliana	Beta carbonic anhydrase 5, chloroplastic	62.302%	Swiss-Prot	strong database homology
`Q9C6F5`	Arabidopsis thaliana	Beta carbonic anhydrase 6, mitochondrial	49.458%	Swiss-Prot	moderate database homology
`Q94CE4`	Arabidopsis thaliana	Beta carbonic anhydrase 4	50.633%	Swiss-Prot	strong database homology
`P27140`	Arabidopsis thaliana	Beta carbonic anhydrase 1, chloroplastic	50.943%	Swiss-Prot	moderate database homology
`Q9ZUC2`	Arabidopsis thaliana	Beta carbonic anhydrase 3	44.882%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card