LXL04_017106 | RubberDandelionOmics

Gene overview

LXL04_017106

Reference: OH-1004 Chr: Chr03 Coordinates: 141292931-141295562 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

501 bp · LXL04_017106|LXL04_017106|OH1004|cDNA

ATGGGCCAAGATCAAAGCAAGCCCACTGATTCCCCCGTACCTATTCCAAAAAGGTCGGAATCGGAATCAGAACCAAAACCGGAATCGGAATCATCTACTCCCCCATCAATGGAATCCTTACTGGCAGAAGCCACGGCATATGGAAACAAAGATAAAGATTTATCAATGGAAGAGAAAGCTCAAAAAGCCCTAGAATGCCCTTGTATTCAAAACCTTAGGAGTGGGCCATGTGGGTCCCAGTTTTCGGACGCCTTTCTATG...

CDS

Download CDS FASTA

501 bp · LXL04_017106|LXL04_017106|OH1004|CDS

ATGGGCCAAGATCAAAGCAAGCCCACTGATTCCCCCGTACCTATTCCAAAAAGGTCGGAATCGGAATCAGAACCAAAACCGGAATCGGAATCATCTACTCCCCCATCAATGGAATCCTTACTGGCAGAAGCCACGGCATATGGAAACAAAGATAAAGATTTATCAATGGAAGAGAAAGCTCAAAAAGCCCTAGAATGCCCTTGTATTCAAAACCTTAGGAGTGGGCCATGTGGGTCCCAGTTTTCGGACGCCTTTCTATG...

Protein

Download Protein FASTA

166 aa · LXL04_017106|LXL04_017106|OH1004|PROTEIN

MGQDQSKPTDSPVPIPKRSESESEPKPESESSTPPSMESLLAEATAYGNKDKDLSMEEKAQKALECPCIQNLRSGPCGSQFSDAFLCFLMSTAEEKGSECVIPFVALQRCIQTNPNAFPKDVLENDDVAKEEKKKPVEDYKIIPPRSRVQQSERVVFNNLVSEPSC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017106`
TK1151 ID	TkA02G074720
OH-1004 ID	LXL04_017106
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	98.600
Protein coverage (%)	TK1151 71.500 / OH-1004 86.145 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017106

Location Chr03:141292931-141295562 (-)

Description Similar to MIA40: Mitochondrial intermembrane space import and assembly protein 40 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g23395`	Required for the import and folding of small cysteine-containing proteins in the mitochondrial intermembrane space (Probable).	Conserved and novel functions for Arabidopsis thaliana MIA40 in assembly of proteins in mitochondria and peroxisomes.2010 · DOI: 10.1074/jbc.m110.121202

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0527700`	Required for the import and folding of small cysteine-containing proteins in the mitochondrial intermembrane space.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017106 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006625 protein targeting to peroxisome Biological Process

GO:0006626 protein targeting to mitochondrion Biological Process

GO:0033108 mitochondrial respiratory chain complex assembly Biological Process

GO:0034599 cellular response to oxidative stress Biological Process

GO:0043504 mitochondrial DNA repair Biological Process

GO:0045041 protein import into mitochondrial intermembrane space Biological Process

GO:0046825 regulation of protein export from nucleus Biological Process

GO:0051604 protein maturation Biological Process

GO:0072655 establishment of protein localization to mitochondrion Biological Process

GO:0160203 mitochondrial disulfide relay system Biological Process

GO:1901857 positive regulation of cellular respiration Biological Process

GO:1990830 cellular response to leukemia inhibitory factor Biological Process

KEGG gene cross-reference

ath:AT5G23395

dosa:Os04g0527700

hsa:131474

mmu:72170

rno:312559

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.807

Rank 1 · LXL04_017106 · OH-1004

Cytoplasm0.139

Rank 2 · LXL04_017106 · OH-1004

Nucleus0.087

Rank 3 · LXL04_017106 · OH-1004

Plastid0.084

Rank 4 · LXL04_017106 · OH-1004

Peroxisome0.042

Rank 5 · LXL04_017106 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GYJ4`	Arabidopsis thaliana	Mitochondrial intermembrane space import and assembly protein 40 homolog	54.054%	Swiss-Prot	strong database homology
`Q7XKI7`	Oryza sativa subsp. japonica	Mitochondrial intermembrane space import and assembly protein 40 homolog	59.524%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card