LXL04_017062 | RubberDandelionOmics

Gene overview

LXL04_017062

Reference: OH-1004 Chr: Chr03 Coordinates: 140351585-140354600 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1050 bp · LXL04_017062|LXL04_017062|OH1004|cDNA

ATGTCTACATTTGGCGTTGCTTCTGCTTCCAACACGAATCCTAACAAGTCCACTGAGGTTGTATCACCTCCTACTGATGGTGTATCAAGCCTTTGCTTCAGTCCCAAAGCGAATTACCTTGTCGCAACTTCATGGGATAACCAGGTAAGATGTTGGGAGGTAACAAAAAACGGAACTTCAGTCAGCACAGCAGCAAAGACATCAATGGCTCATGAACTTCCGGCTTTATGTTCAACATGGAAAGATGATGGAACAACGGT...

CDS

Download CDS FASTA

1050 bp · LXL04_017062|LXL04_017062|OH1004|CDS

ATGTCTACATTTGGCGTTGCTTCTGCTTCCAACACGAATCCTAACAAGTCCACTGAGGTTGTATCACCTCCTACTGATGGTGTATCAAGCCTTTGCTTCAGTCCCAAAGCGAATTACCTTGTCGCAACTTCATGGGATAACCAGGTAAGATGTTGGGAGGTAACAAAAAACGGAACTTCAGTCAGCACAGCAGCAAAGACATCAATGGCTCATGAACTTCCGGCTTTATGTTCAACATGGAAAGATGATGGAACAACGGT...

Protein

Download Protein FASTA

349 aa · LXL04_017062|LXL04_017062|OH1004|PROTEIN

MSTFGVASASNTNPNKSTEVVSPPTDGVSSLCFSPKANYLVATSWDNQVRCWEVTKNGTSVSTAAKTSMAHELPALCSTWKDDGTTVFSGGCDKQVKMWPLLSGGQPSTVAMHDGPVTSIAWIPEMSLLVSGSWDKTLRYWDLRQQNPVHTQQLPDRCYGLTVRHPLMVVATADRNLIAFNLQNPQTEFKRIVSPLKYQTRCVAAFPDQQGFLVGSIEGRVGVHHLDEQQNSKNFTFKCHREGNEVYSVNSLNFHPVHQT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017062`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017062

Location Chr03:140351585-140354600 (-)

Description Similar to RAE1: Protein RAE1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g80670`	Protein RAE1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017062 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000972 transcription-dependent tethering of RNA polymerase II gene DNA at nuclear periphery Biological Process

GO:0006405 RNA export from nucleus Biological Process

GO:0006406 mRNA export from nucleus Biological Process

GO:0006913 nucleocytoplasmic transport Biological Process

GO:0015031 protein transport Biological Process

GO:0051028 mRNA transport Biological Process

GO:0051301 cell division Biological Process

GO:0060236 regulation of mitotic spindle organization Biological Process

GO:0001650 fibrillar center Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005635 nuclear envelope Cellular Component

GO:0005643 nuclear pore Cellular Component

KEGG gene cross-reference

ath:AT1G80670

dre:393973

hsa:8480

pon:100171527

ssc:100125839

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.776

Rank 1 · LXL04_017062 · OH-1004

Cytoplasm0.319

Rank 2 · LXL04_017062 · OH-1004

Cell membrane0.047

Rank 3 · LXL04_017062 · OH-1004

Mitochondrion0.028

Rank 4 · LXL04_017062 · OH-1004

Endoplasmic reticulum0.023

Rank 5 · LXL04_017062 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25174.2Beta-prop_THOC311-87 aa

PF24807.2WD40_CDC20-Fz13-152 aa

PF24814.2WD40_Prp1915-157 aa

PF24817.2WD40_WDHD1_1st17-61 aa

PF25175.2Beta-prop_WDR519-234 aa

PF25173.2Beta-prop_WDR3_1st19-181 aa

PF00400.39WD4023-52 aa

PF23409.2Beta-prop_EML23-162 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017062	`PF25174.2`	Beta-prop_THOC3	11	87	6.2e-36	124.5
LXL04_017062	`PF24807.2`	WD40_CDC20-Fz	13	152	1.2e-19	71.5
LXL04_017062	`PF24814.2`	WD40_Prp19	15	157	6.7e-30	104.8
LXL04_017062	`PF24817.2`	WD40_WDHD1_1st	17	61	3e-29	102.8
LXL04_017062	`PF25175.2`	Beta-prop_WDR5	19	234	4.4e-30	105.7
LXL04_017062	`PF25173.2`	Beta-prop_WDR3_1st	19	181	3.3e-29	102.6
LXL04_017062	`PF00400.39`	WD40	23	52	2.2e-28	98.2
LXL04_017062	`PF23409.2`	Beta-prop_EML	23	162	8.4e-12	45.8
LXL04_017062	`PF23414.2`	Beta-prop_EML_2	24	106	3.8e-21	76.4
LXL04_017062	`PF23381.2`	Beta-prop_IFT122_1st	25	176	9.8e-32	111.1
LXL04_017062	`PF24796.2`	WDR55	26	233	1.4e-20	74.3
LXL04_017062	`PF25391.2`	WD40_Gbeta	28	146	9.8e-13	48.5
LXL04_017062	`PF25047.1`	Beta-prop_TEP1_2nd	69	151	8e-12	45.6
LXL04_017062	`PF25172.2`	Beta-prop_WDR3_2nd	70	175	1.8e-19	70.8
LXL04_017062	`PF24817.2`	WD40_WDHD1_1st	72	154	3e-29	102.8
LXL04_017062	`PF25174.2`	Beta-prop_THOC3	79	306	6.2e-36	124.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q38942`	Arabidopsis thaliana	Protein RAE1	79.083%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card