LXL04_017018 | RubberDandelionOmics

Gene overview

LXL04_017018

Reference: OH-1004 Chr: Chr03 Coordinates: 138998849-138999586 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

738 bp · LXL04_017018|LXL04_017018|OH1004|cDNA

ATGAACGATGATGAAGTAGACGCAAACAATGGAACCACTCAACCTCCATCAGATCCTCTTCTCCAATGGAGCATATGGCAATTACTCGATTCCATTCTCCCAACCGGCGGATTCGCCCATTCCTTCGGTCTCGAAGCCGGAATGCAATCCCGCATAGTCTCTCACCCGGAAGACCTCCAAACACACGTAATCCACGTCCTCGAAAACACCGCAAGTCTCCTCCTTCCATTCGTATACGCCGCCACAACCTCACCAAATCT...

CDS

Download CDS FASTA

738 bp · LXL04_017018|LXL04_017018|OH1004|CDS

ATGAACGATGATGAAGTAGACGCAAACAATGGAACCACTCAACCTCCATCAGATCCTCTTCTCCAATGGAGCATATGGCAATTACTCGATTCCATTCTCCCAACCGGCGGATTCGCCCATTCCTTCGGTCTCGAAGCCGGAATGCAATCCCGCATAGTCTCTCACCCGGAAGACCTCCAAACACACGTAATCCACGTCCTCGAAAACACCGCAAGTCTCCTCCTTCCATTCGTATACGCCGCCACAACCTCACCAAATCT...

Protein

Download Protein FASTA

245 aa · LXL04_017018|LXL04_017018|OH1004|PROTEIN

MNDDEVDANNGTTQPPSDPLLQWSIWQLLDSILPTGGFAHSFGLEAGMQSRIVSHPEDLQTHVIHVLENTASLLLPFVYAATTSPNLATWQHLDAILDATLTNDVSRKASVSQGSALMRVSASVFSEIPELKTMRAAAVSGGNVAVRFHHAPVFGVVCGLIGLDGETAQRAYLFVTMRDVISAATRLNLVGPLGAAVLQHQVAVVAEEVLRKWKNRGVEEACQTSPLLDTVQGCHSYLFSRLFCS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017018`
TK1151 ID	TkA02G084000
OH-1004 ID	LXL04_017018
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017018

Location Chr03:138998849-138999586 (-)

Description Similar to UREF: Urease accessory protein F

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g21840`	Required for the maturation and activation of urease via the functional incorporation of the urease nickel metallocenter.	Identification of three urease accessory proteins that are required for urease activation in Arabidopsis.2005 · DOI: 10.1104/pp.105.070292

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0168000`	Required for the maturation and activation of urease via the functional incorporation of the urease nickel metallocenter.	No verified direct reference in this release
`UniProt: E0ZS46`	Required for the maturation and activation of urease via the functional incorporation of the urease nickel metallocenter.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017018 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0019627 urea metabolic process Biological Process

GO:0043419 urea catabolic process Biological Process

GO:0051604 protein maturation Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0016151 nickel cation binding Molecular Function

GO:0018237 urease activator activity Molecular Function

KEGG gene cross-reference

ath:AT1G21840

cyc:PCC7424_4416

dosa:Os02g0168000

ter:Tery_0751

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.662

Rank 1 · LXL04_017018 · OH-1004

Nucleus0.290

Rank 2 · LXL04_017018 · OH-1004

Peroxisome0.223

Rank 3 · LXL04_017018 · OH-1004

Mitochondrion0.082

Rank 4 · LXL04_017018 · OH-1004

Plastid0.042

Rank 5 · LXL04_017018 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01730.22UreF53-202 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017018	`PF01730.22`	UreF	53	202	2.7e-25	90.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XHZ3`	Arabidopsis thaliana	Urease accessory protein F	67.635%	Swiss-Prot	strong database homology
`Q0E3L5`	Oryza sativa subsp. japonica	Urease accessory protein F	69.058%	Swiss-Prot	strong database homology
`E0ZS46`	Oryza sativa subsp. indica	Urease accessory protein F	69.058%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card