LXL04_016993 | RubberDandelionOmics

Gene overview

LXL04_016993

Reference: OH-1004 Chr: Chr03 Coordinates: 138647338-138648123 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

786 bp · LXL04_016993|LXL04_016993|OH1004|cDNA

ATGGCTGAAGCAGTAGCAGCAGGTGCTGGTGTGGCAGCAACAGTTATCCAAGCTAAGGCAATATTATTGCAACCACTAAAGCAAACAATTGCATCATCCAATGATATGGACGAAATCTATGGAGAGTTGGATCGTGTAATGGAAACACTCATTGCAAGAAGAAACGATCTTGAGGACATGGCCCACAATCGCAAGACAACAATGATGTCATCCAACACCTATACCGATTGGAATACAAGAGTAGATGTGGTTGCAAAAGA...

CDS

Download CDS FASTA

786 bp · LXL04_016993|LXL04_016993|OH1004|CDS

ATGGCTGAAGCAGTAGCAGCAGGTGCTGGTGTGGCAGCAACAGTTATCCAAGCTAAGGCAATATTATTGCAACCACTAAAGCAAACAATTGCATCATCCAATGATATGGACGAAATCTATGGAGAGTTGGATCGTGTAATGGAAACACTCATTGCAAGAAGAAACGATCTTGAGGACATGGCCCACAATCGCAAGACAACAATGATGTCATCCAACACCTATACCGATTGGAATACAAGAGTAGATGTGGTTGCAAAAGA...

Protein

Download Protein FASTA

261 aa · LXL04_016993|LXL04_016993|OH1004|PROTEIN

MAEAVAAGAGVAATVIQAKAILLQPLKQTIASSNDMDEIYGELDRVMETLIARRNDLEDMAHNRKTTMMSSNTYTDWNTRVDVVAKEVDELKVRYTKENKRSPWFSINACCNFTKKMNNHIKVAEMFDVVIWVYVSRKGSMKHRDINQIQQDIIERLELNIGITSNVDIIANRIRAELTNIKYLLLLDDVNEDLDLDKIGVPMRENGSKIVITTRLQRVYSSIATTQINVEILKPTEAVELFKSELNFPFLRRTPTLKTN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016993`
TK1151 ID	TkA02G084720
OH-1004 ID	LXL04_016993
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 46.360 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016993

Location Chr03:138647338-138648123 (-)

Description Similar to At1g61300: Probable disease resistance protein At1g61300

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g61300`	Probable disease resistance protein.	No verified direct reference in this release
`At1g51480`	Probable disease resistance protein.	No verified direct reference in this release
`At5g43730`	Probable disease resistance protein.	No verified direct reference in this release
`At5g63020`	Probable disease resistance protein.	No verified direct reference in this release
`At1g61190`	Probable disease resistance protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016993 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0098542 defense response to other organism Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0043531 ADP binding Molecular Function

KEGG gene cross-reference

ath:AT1G51480

ath:AT1G61190

ath:AT1G61300

ath:AT5G43730

ath:AT5G63020

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.765

Rank 1 · LXL04_016993 · OH-1004

Cytoplasm0.102

Rank 2 · LXL04_016993 · OH-1004

Endoplasmic reticulum0.099

Rank 3 · LXL04_016993 · OH-1004

Extracellular0.068

Rank 4 · LXL04_016993 · OH-1004

Nucleus0.062

Rank 5 · LXL04_016993 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00931.29NB-ARC115-245 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016993	`PF00931.29`	NB-ARC	115	245	8.4e-22	78.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O64790`	Arabidopsis thaliana	Probable disease resistance protein At1g61300	33.333%	Swiss-Prot	moderate database homology
`Q9C8K0`	Arabidopsis thaliana	Probable disease resistance protein At1g51480	41.007%	Swiss-Prot	moderate database homology
`Q9FG91`	Arabidopsis thaliana	Probable disease resistance protein At5g43730	42.308%	Swiss-Prot	weak database homology
`Q8RXS5`	Arabidopsis thaliana	Probable disease resistance protein At5g63020	34.899%	Swiss-Prot	moderate database homology
`O22727`	Arabidopsis thaliana	Probable disease resistance protein At1g61190	32.000%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card