LXL04_016936 | RubberDandelionOmics

Gene overview

LXL04_016936

Reference: OH-1004 Chr: Chr03 Coordinates: 137261676-137265568 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1197 bp · LXL04_016936|LXL04_016936|OH1004|cDNA

ATGTCTCTCATTCAAACATCTCTACAGCAATGTCCGGCATCCGCTACCGCTTTCTCACAGTTTCTTCCTTCACCGTTATCACATTCTTCTACTAAGTTCTCCGTCAGATTCAACGTCTCATGCTGTATCTCCTCGTCGCCGGTGACCATCGTCAATGGAAACGTCGACGTGAAATCCGCAGATAGGAATGAAATTAGATTAGGTTTGCCAAGTAAAGGTCGAATGGCTACCGATACGCTCGATCTTCTCAAAGATTGTCA...

CDS

Download CDS FASTA

1197 bp · LXL04_016936|LXL04_016936|OH1004|CDS

ATGTCTCTCATTCAAACATCTCTACAGCAATGTCCGGCATCCGCTACCGCTTTCTCACAGTTTCTTCCTTCACCGTTATCACATTCTTCTACTAAGTTCTCCGTCAGATTCAACGTCTCATGCTGTATCTCCTCGTCGCCGGTGACCATCGTCAATGGAAACGTCGACGTGAAATCCGCAGATAGGAATGAAATTAGATTAGGTTTGCCAAGTAAAGGTCGAATGGCTACCGATACGCTCGATCTTCTCAAAGATTGTCA...

Protein

Download Protein FASTA

398 aa · LXL04_016936|LXL04_016936|OH1004|PROTEIN

MSLIQTSLQQCPASATAFSQFLPSPLSHSSTKFSVRFNVSCCISSSPVTIVNGNVDVKSADRNEIRLGLPSKGRMATDTLDLLKDCQLSVRQLNPRQYVADIPQLSNVEVWFQRPKDIVRKLVAGDLDLGIVGLDIVSEFGQGNEDLVLVHDELAYGDCRLSLAIPKYGIFEKINSVKELAQMPQWTAEKPLRVATGFTYLGPKFLKENGLEHVVFSTADGALEAAPAMGIADAIVDLVSSGTTLKENNLKEIEGGVLLE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016936`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016936

Location Chr03:137261676-137265568 (+)

Description Similar to HISN1B: ATP phosphoribosyltransferase 2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g09795`	Catalyzes the condensation of ATP and 5-phosphoribose 1-diphosphate to form N'-(5'-phosphoribosyl)-ATP (PR-ATP).	No verified direct reference in this release
`At1g58080`	Catalyzes the condensation of ATP and 5-phosphoribose 1-diphosphate to form N'-(5'-phosphoribosyl)-ATP (PR-ATP).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0134300`	Catalyzes the condensation of ATP and 5-phosphoribose 1-diphosphate to form N'-(5'-phosphoribosyl)-ATP (PR-ATP).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016936 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000105 L-histidine biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0003879 ATP phosphoribosyltransferase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G09795

ath:AT1G58080

bfr:BF3190

dosa:Os03g0134300

gau:GAU_0140

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.966

Rank 1 · LXL04_016936 · OH-1004

Mitochondrion0.045

Rank 2 · LXL04_016936 · OH-1004

Cytoplasm0.039

Rank 3 · LXL04_016936 · OH-1004

Nucleus0.036

Rank 4 · LXL04_016936 · OH-1004

Peroxisome0.027

Rank 5 · LXL04_016936 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01634.24HisG114-278 aa

PF08029.17HisG_C297-379 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016936	`PF01634.24`	HisG	114	278	2.2e-38	132.4
LXL04_016936	`PF08029.17`	HisG_C	297	379	1.7e-12	48.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GSJ1`	Arabidopsis thaliana	ATP phosphoribosyltransferase 2, chloroplastic	76.177%	Swiss-Prot	strong database homology
`Q9S762`	Arabidopsis thaliana	ATP phosphoribosyltransferase 1, chloroplastic	69.643%	Swiss-Prot	strong database homology
`Q10S55`	Oryza sativa subsp. japonica	ATP phosphoribosyltransferase, chloroplastic	71.976%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card