LXL04_016911 | RubberDandelionOmics

Gene overview

LXL04_016911

Reference: OH-1004 Chr: Chr03 Coordinates: 136765295-136769162 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1539 bp · LXL04_016911|LXL04_016911|OH1004|cDNA

ATGGGATCATCATCGGCAGATTCAATCTCTCCCCAATCATCAGCCACCGGAGAAAATGTAATAGTGGTGATGAACGGAAACAGGGGAAAGGGAAACCTCGATGCTCTAGAGTGGGCGATTAAGTATATCGTTGGCCCAAATGACACCGTCGTTGTTCTCGGAGTGTTGCCGGAAATCGGCAGGAAACCCACTCCTTCTTGTTTACCTTTTCACCTCGGAATCGGCACCTCCGGCATCTGGATAAAACTCGAGTTTTCACA...

CDS

Download CDS FASTA

1539 bp · LXL04_016911|LXL04_016911|OH1004|CDS

ATGGGATCATCATCGGCAGATTCAATCTCTCCCCAATCATCAGCCACCGGAGAAAATGTAATAGTGGTGATGAACGGAAACAGGGGAAAGGGAAACCTCGATGCTCTAGAGTGGGCGATTAAGTATATCGTTGGCCCAAATGACACCGTCGTTGTTCTCGGAGTGTTGCCGGAAATCGGCAGGAAACCCACTCCTTCTTGTTTACCTTTTCACCTCGGAATCGGCACCTCCGGCATCTGGATAAAACTCGAGTTTTCACA...

Protein

Download Protein FASTA

512 aa · LXL04_016911|LXL04_016911|OH1004|PROTEIN

MGSSSADSISPQSSATGENVIVVMNGNRGKGNLDALEWAIKYIVGPNDTVVVLGVLPEIGRKPTPSCLPFHLGIGTSGIWIKLEFSHNEMTPSELQQAIGRKKREYQKFLQPYYHHCKKREVKLDIRLAAGYESKKLAVEEAEKLDPRWIVLDGYLKKDKEYIHKNVDCHVALLKEKGVATLIPSKITGPECEEWQTVCKKIDDQAFTDDDIMEEEIKEPNSPKQTPLTPSSYPLSWRTGFPRAFSLDEIEEITNGFKNV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016911`
TK1151 ID	TkA02G093190
OH-1004 ID	LXL04_016911
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016911

Location Chr03:136765295-136769162 (-)

Description Similar to CCR1: Serine/threonine-protein kinase-like protein CCR1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g38560`	Could be involved in the negative regulation of root growth.	PERK-KIPK-KCBP signalling negatively regulates root growth in Arabidopsis thaliana.2015 · DOI: 10.1093/jxb/eru390
`At5g10520`	Receptor-like cytosolic serine/threonine-protein kinase RBK1.	No verified direct reference in this release
`At3g09780`	Serine/threonine-protein kinase with low activity.	No verified direct reference in this release
`At1g48210`	Receptor-like cytoplasmic kinase (RLCK) that triggers abscisic acid (ABA) signaling in response to dehydration by phosphorylating and activating ABA receptors (e.g. PYR1/RCAR11, PYL1/RCAR12, PYL3/RCAR13 and PYL2/RCAR14) to support their monomerization and enhance their ABA binding affinity; they in turn repress PP2C protein phosphatases acting as negative regulators of ABA responses.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016911 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0071369 cellular response to ethylene stimulus Biological Process

GO:0098542 defense response to other organism Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0012505 endomembrane system Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G48210

ath:AT3G09780

ath:AT5G10520

ath:AT5G38560

sly:544006

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.541

Rank 1 · LXL04_016911 · OH-1004

Cytoplasm0.338

Rank 2 · LXL04_016911 · OH-1004

Nucleus0.289

Rank 3 · LXL04_016911 · OH-1004

Endoplasmic reticulum0.042

Rank 4 · LXL04_016911 · OH-1004

Golgi apparatus0.032

Rank 5 · LXL04_016911 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714.24PK_Tyr_Ser-Thr292-364 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016911	`PF07714.24`	PK_Tyr_Ser-Thr	292	364	6.5e-06	26.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FFW5`	Arabidopsis thaliana	Proline-rich receptor-like protein kinase PERK8	27.336%	Swiss-Prot	weak database homology
`Q8H1D6`	Arabidopsis thaliana	Receptor-like cytosolic serine/threonine-protein kinase RBK1	27.900%	Swiss-Prot	weak database homology
`Q9S7D9`	Arabidopsis thaliana	Serine/threonine-protein kinase-like protein CCR1	27.575%	Swiss-Prot	weak database homology
`F4HWU0`	Arabidopsis thaliana	Protein CYTOSOLIC ABA RECEPTOR KINASE 11	24.272%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card