LXL04_016903 | RubberDandelionOmics

Gene overview

LXL04_016903

Reference: OH-1004 Chr: Chr03 Coordinates: 136419357-136423565 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1178 bp · LXL04_016903|LXL04_016903|OH1004|cDNA

GTTTCGTGTTCGGTGTTCCCCTCTGCCTTTTTTTTGTCGACTTTTACCTCTCTACTTCATCATCTGAGCCGATAACGAAAGATTATCCCCGAAAAATCGTCATGTCGGAGGTGAACGAGAAGGTTTCTGATGTCAAGCCTACGACCGGCACCGAAGAAAAGACTGCTTCAGCCATGAAGAAAACCTCTGAATCAAGCTCCTCAAATCCCTTATCTGGAACAACACCCACCATACCATCCATACCAGGAGCTGGAATCCCT...

CDS

Download CDS FASTA

1077 bp · LXL04_016903|LXL04_016903|OH1004|CDS

ATGTCGGAGGTGAACGAGAAGGTTTCTGATGTCAAGCCTACGACCGGCACCGAAGAAAAGACTGCTTCAGCCATGAAGAAAACCTCTGAATCAAGCTCCTCAAATCCCTTATCTGGAACAACACCCACCATACCATCCATACCAGGAGCTGGAATCCCTGCAAATCCATTTGACTTCTCATCAATGGCTGGCCTACTTAATGATCCAAGTGTAAAGGAACTAGCTGAACAAATAGCAAAAGATCCATCATTCAACCAAAT...

Protein

Download Protein FASTA

358 aa · LXL04_016903|LXL04_016903|OH1004|PROTEIN

MSEVNEKVSDVKPTTGTEEKTASAMKKTSESSSSNPLSGTTPTIPSIPGAGIPANPFDFSSMAGLLNDPSVKELAEQIAKDPSFNQMAEQLQKTFHGGETGGAGGGVPQFDTQQYYSTMQQVMQNPQFMNMAERLGSALMQDPSMSQMLESLSNPAQKDQLEERMARIKEDPSLKHILDDIETGGPTAMMRYWNDKDVLAKLGEAMGLPVTGDPTAFAGNSGAVEAEEEEVNDDESLVHQTASVGDVEGLKKVLESGGDK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016903`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016903

Location Chr03:136419357-136423565 (+)

Description Similar to AKR2B: Ankyrin repeat domain-containing protein 2B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g17390`	Exhibits chaperone activity toward chloroplast outer envelope membrane, mitochondrion outer membrane, endoplasmic reticulum membrane and peroxisomal proteins, by recruiting specific proteins containing a single transmembrane associated with an AKR2A-binding sequence (ABS) and subsequently binding glycolipids (e.g. monogalactosyldiacylglycerol (MGDG) and phosphatidylglycerol (PG)) present in the membrane of the target organelle.	No verified direct reference in this release
`At4g35450`	Exhibits chaperone activity toward chloroplast outer envelope membrane, mitochondrion outer membrane, endoplasmic reticulum membrane and peroxisomal proteins, by recruiting specific proteins containing a single transmembrane associated with an AKR2A-binding sequence (ABS) and subsequently binding glycolipids (e.g. monogalactosyldiacylglycerol (MGDG) and phosphatidylglycerol (PG)) present in the membrane of the target organelle.	An ankyrin repeat-containing protein plays a role in both disease resistance and antioxidation metabolism.2002 · DOI: 10.1046/j.0960-7412.2001.01205.x AKR2A-mediated import of chloroplast outer membrane proteins is essential for chloroplast biogenesis.2008 · DOI: 10.1038/ncb1683 ANKYRIN REPEAT-CONTAINING PROTEIN 2A is an essential molecular chaperone for peroxisomal membrane-bound ASCORBATE PEROXIDASE3 in Arabidopsis.2010 · DOI: 10.1105/tpc.109.065979

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016903 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006457 protein folding Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045036 protein targeting to chloroplast Biological Process

GO:0070417 cellular response to cold Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT2G17390

ath:AT4G35450

bta:534898

hsa:157567

pon:100173109

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.649

Rank 1 · LXL04_016903 · OH-1004

Nucleus0.249

Rank 2 · LXL04_016903 · OH-1004

Peroxisome0.225

Rank 3 · LXL04_016903 · OH-1004

Mitochondrion0.136

Rank 4 · LXL04_016903 · OH-1004

Golgi apparatus0.080

Rank 5 · LXL04_016903 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17830.7STI1-HOP_DP163-207 aa

PF24521.3Ank_KRIT1233-347 aa

PF12796.14Ank_2239-329 aa

PF13606.13Ank_3266-294 aa

PF00023.37Ank267-298 aa

PF13637.13Ank_4271-320 aa

PF13857.13Ank_5286-340 aa

PF12796.14Ank_2298-353 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016903	`PF17830.7`	STI1-HOP_DP	163	207	2.5e-14	53.6
LXL04_016903	`PF24521.3`	Ank_KRIT1	233	347	4.6e-08	33.6
LXL04_016903	`PF12796.14`	Ank_2	239	329	9.4e-29	100.5
LXL04_016903	`PF13606.13`	Ank_3	266	294	5.2e-13	48.5
LXL04_016903	`PF00023.37`	Ank	267	298	5.4e-19	67.9
LXL04_016903	`PF13637.13`	Ank_4	271	320	9.8e-18	64.6
LXL04_016903	`PF13857.13`	Ank_5	286	340	2.6e-14	53.9
LXL04_016903	`PF12796.14`	Ank_2	298	353	9.4e-29	100.5
LXL04_016903	`PF00023.37`	Ank	299	330	5.4e-19	67.9
LXL04_016903	`PF13606.13`	Ank_3	300	326	5.2e-13	48.5
LXL04_016903	`PF13637.13`	Ank_4	305	352	9.8e-18	64.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q29Q26`	Arabidopsis thaliana	Ankyrin repeat domain-containing protein 2B	66.097%	Swiss-Prot	strong database homology
`Q9SAR5`	Arabidopsis thaliana	Ankyrin repeat domain-containing protein 2A	62.291%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card