LXL04_016870 | RubberDandelionOmics

Gene overview

LXL04_016870

Reference: OH-1004 Chr: Chr03 Coordinates: 135877333-135884241 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2451 bp · LXL04_016870|LXL04_016870|OH1004|cDNA

ATGGCAATGGAAATAGTCATATGCAGGTGCGAGCGACGGAGCGAGACAGAAGGTGTGTCACAGGACACCCTTTGGTTCAAGGTGTACTCGCCCCTGGGTGCAGACACTCGTAAAAGCTTCATTGGCCATCTTTATCAGGCTCTTCAGGATAAGGGCATTTACACATACAAGGACGACGAAAGAATCACAAAAGGGAAAATGATCAGTGATAATCTCCTCGAATCCATTGAAGACTCACGATTTTACATCGTAGTTTTCTC...

CDS

Download CDS FASTA

2451 bp · LXL04_016870|LXL04_016870|OH1004|CDS

ATGGCAATGGAAATAGTCATATGCAGGTGCGAGCGACGGAGCGAGACAGAAGGTGTGTCACAGGACACCCTTTGGTTCAAGGTGTACTCGCCCCTGGGTGCAGACACTCGTAAAAGCTTCATTGGCCATCTTTATCAGGCTCTTCAGGATAAGGGCATTTACACATACAAGGACGACGAAAGAATCACAAAAGGGAAAATGATCAGTGATAATCTCCTCGAATCCATTGAAGACTCACGATTTTACATCGTAGTTTTCTC...

Protein

Download Protein FASTA

816 aa · LXL04_016870|LXL04_016870|OH1004|PROTEIN

MAMEIVICRCERRSETEGVSQDTLWFKVYSPLGADTRKSFIGHLYQALQDKGIYTYKDDERITKGKMISDNLLESIEDSRFYIVVFSKNYASSSWCLKELVKIMECHNTKKHIAYPVFLDVEPTEVRYQTGAVGETFSKHVNKEAAGKWRKALKDAADLAGWELKNTADGSEASFIKKIIEDISIELYNINFSFDKNLVGIETRVNDIVSSLQTGIVDVRMIGIKGMGGAGKTTLARAVFDKISIQFEGKSFVENVREVT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016870`
TK1151 ID	TkA02G096110
OH-1004 ID	LXL04_016870
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.200
Protein coverage (%)	TK1151 98.881 / OH-1004 97.304 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016870

Location Chr03:135877333-135884241 (-)

Description Similar to N: TMV resistance protein N

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g12010`	TIR-NB-LRR receptor-like protein involved in plant defense.	Matching NLR Immune Receptors to Autoimmunity in camta3 Mutants Using Antimorphic NLR Alleles.2017 · DOI: 10.1016/j.chom.2017.03.005

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016870 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0019677 NAD+ catabolic process Biological Process

GO:0043068 positive regulation of programmed cell death Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0003953 NAD+ nucleosidase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0043531 ADP binding Molecular Function

GO:0050135 NADP+ nucleosidase activity Molecular Function

GO:0061809 NAD+ nucleosidase activity, cyclic ADP-ribose generating Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.482

Rank 1 · LXL04_016870 · OH-1004

Cell membrane0.274

Rank 2 · LXL04_016870 · OH-1004

Nucleus0.254

Rank 3 · LXL04_016870 · OH-1004

Endoplasmic reticulum0.096

Rank 4 · LXL04_016870 · OH-1004

Extracellular0.056

Rank 5 · LXL04_016870 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01582.26TIR26-190 aa

PF13676.12TIR_238-123 aa

PF00931.29NB-ARC202-374 aa

PF23282.2WHD_ROQ1443-510 aa

PF23598.2LRR_14659-739 aa

PF13855.13LRR_8683-741 aa

PF25019.1LRR_R13L1-DRL21697-762 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016870	`PF01582.26`	TIR	26	190	7e-44	150.5
LXL04_016870	`PF13676.12`	TIR_2	38	123	9.8e-12	46.1
LXL04_016870	`PF00931.29`	NB-ARC	202	374	1.8e-21	77.2
LXL04_016870	`PF23282.2`	WHD_ROQ1	443	510	5.1e-15	56.1
LXL04_016870	`PF23598.2`	LRR_14	659	739	3.2e-17	63.0
LXL04_016870	`PF13855.13`	LRR_8	683	741	6.4e-08	33.0
LXL04_016870	`PF25019.1`	LRR_R13L1-DRL21	697	762	1.3e-06	29.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SZ66`	Arabidopsis thaliana	Disease resistance-like protein DSC1	34.831%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card