Gene Card
Gene overview
cDNA / CDS / Protein Sequences
240 bp · LXL04_016583|LXL04_016583|OH1004|cDNA
ATGCGATTTGACTTCAAATCAGACACTGTCTTGGAACTTGAATTTCAAGGTGTTAAAAAGAAATTCACCATGCTTCAGACTTGGCATGTATGTACACCTTGCTCTGTTGCATCAAAGCTTGCTGCTGATACTCTTCTTACTGGACAACGTGTTCTTGATGCCCTTTTCCCCTTAGTGCTCGGTCGTACATGTGACATTCCTGGTGCTTTTGGTTGTGGGAAGATGATTGAGATCACATAA
240 bp · LXL04_016583|LXL04_016583|OH1004|CDS
ATGCGATTTGACTTCAAATCAGACACTGTCTTGGAACTTGAATTTCAAGGTGTTAAAAAGAAATTCACCATGCTTCAGACTTGGCATGTATGTACACCTTGCTCTGTTGCATCAAAGCTTGCTGCTGATACTCTTCTTACTGGACAACGTGTTCTTGATGCCCTTTTCCCCTTAGTGCTCGGTCGTACATGTGACATTCCTGGTGCTTTTGGTTGTGGGAAGATGATTGAGATCACATAA
Protein
Download Protein FASTA79 aa · LXL04_016583|LXL04_016583|OH1004|PROTEIN
MRFDFKSDTVLELEFQGVKKKFTMLQTWHVCTPCSVASKLAADTLLTGQRVLDALFPLVLGRTCDIPGAFGCGKMIEIT
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_016583 |
|---|---|
| TK1151 ID | TkA02G556410 |
| OH-1004 ID | LXL04_016583 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 98.600 |
| Protein coverage (%) | TK1151 67.593 / OH-1004 92.405Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_016583 |
|---|---|
| Location | Chr03:127474667-127475683 (-) |
| Description | Similar to V-type proton ATPase catalytic subunit A |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0046034 ATP metabolic process Biological Process GO:0090377 seed trichome initiation Biological Process GO:0090378 seed trichome elongation Biological Process GO:1902600 proton transmembrane transport Biological Process GO:0000325 plant-type vacuole Cellular Component GO:0009705 plant-type vacuole membrane Cellular Component GO:0033180 proton-transporting V-type ATPase, V1 domain Cellular Component GO:0005524 ATP binding Molecular Function GO:0016887 ATP hydrolysis activity Molecular Function GO:0046961 proton-transporting ATPase activity, rotational mechanism Molecular Function |
| KEGG gene cross-reference | ghi:107930394 vra:106773955 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.