LXL04_016429 | RubberDandelionOmics

Gene overview

LXL04_016429

Reference: OH-1004 Chr: Chr03 Coordinates: 122857736-122868475 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2514 bp · LXL04_016429|LXL04_016429|OH1004|cDNA

ATGATTAGGACACGATTGGATGAGAAGTGGTCATGGTTGACGGCATCAATGGCGGAAGAAGGACGAGTTACCAAGTTTTGGTTTGCTATCGTTGTACTTTCTGCAGTGATAACTTGTACCACGGCGGTAGACACCATCCACGCAGGCCAAACCATTAAAGACGGCGAAACCATCGTTTCAGCTCAAGACAGCTTCGAGCTTGGTTTCTTCAGCCCCGTAAACTCCAGAAACAGGTATGTCGGTATCTGGTACAAGAGAAT...

CDS

Download CDS FASTA

2514 bp · LXL04_016429|LXL04_016429|OH1004|CDS

ATGATTAGGACACGATTGGATGAGAAGTGGTCATGGTTGACGGCATCAATGGCGGAAGAAGGACGAGTTACCAAGTTTTGGTTTGCTATCGTTGTACTTTCTGCAGTGATAACTTGTACCACGGCGGTAGACACCATCCACGCAGGCCAAACCATTAAAGACGGCGAAACCATCGTTTCAGCTCAAGACAGCTTCGAGCTTGGTTTCTTCAGCCCCGTAAACTCCAGAAACAGGTATGTCGGTATCTGGTACAAGAGAAT...

Protein

Download Protein FASTA

837 aa · LXL04_016429|LXL04_016429|OH1004|PROTEIN

MIRTRLDEKWSWLTASMAEEGRVTKFWFAIVVLSAVITCTTAVDTIHAGQTIKDGETIVSAQDSFELGFFSPVNSRNRYVGIWYKRISNRTVVWVANRNTPLTNTSGELSLTLQGTLVIRSATGNVIWSVTNSSVGNPIGRLLDTGNFIIMNGEDLENPVWQSFDFPTDTFLPGMKFGKDLITGLERRFTSWKNDGDPSDGEFTVSIDTQGYPQMVVREGSDIVFRAGPWNGVRFTGTPNLKPNSIYRFGFVLDQKEMYY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016429`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016429

Location Chr03:122857736-122868475 (-)

Description Similar to At4g27290: G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g27290`	G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290.	No verified direct reference in this release
`At4g21380`	Involved in the regulation of cellular expansion and differentiation.	No verified direct reference in this release
`At4g27300`	G-type lectin S-receptor-like serine/threonine-protein kinase SD1-1.	No verified direct reference in this release
`At1g65800`	Involved in the regulation of cellular expansion and differentiation.	No verified direct reference in this release
`At1g65790`	Involved in the regulation of cellular expansion and differentiation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016429 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0006955 immune response Biological Process

GO:0007165 signal transduction Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0048544 recognition of pollen Biological Process

GO:0071215 cellular response to abscisic acid stimulus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G65790

ath:AT1G65800

ath:AT4G21380

ath:AT4G27290

ath:AT4G27300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.869

Rank 1 · LXL04_016429 · OH-1004

Endoplasmic reticulum0.077

Rank 2 · LXL04_016429 · OH-1004

Cytoplasm0.067

Rank 3 · LXL04_016429 · OH-1004

Nucleus0.033

Rank 4 · LXL04_016429 · OH-1004

Lysosome / Vacuole0.026

Rank 5 · LXL04_016429 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01453.31B_lectin91-193 aa

PF00954.26S_locus_glycop225-333 aa

PF08276.18PAN_2355-421 aa

PF00069.32Pkinase520-785 aa

PF07714.24PK_Tyr_Ser-Thr522-788 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016429	`PF01453.31`	B_lectin	91	193	2.8e-33	115.2
LXL04_016429	`PF00954.26`	S_locus_glycop	225	333	1.2e-30	107.1
LXL04_016429	`PF08276.18`	PAN_2	355	421	1.2e-19	70.9
LXL04_016429	`PF00069.32`	Pkinase	520	785	4.3e-45	154.9
LXL04_016429	`PF07714.24`	PK_Tyr_Ser-Thr	522	788	1.6e-49	169.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O81832`	Arabidopsis thaliana	G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290	50.798%	Swiss-Prot	strong database homology
`O81905`	Arabidopsis thaliana	Receptor-like serine/threonine-protein kinase SD1-8	47.052%	Swiss-Prot	moderate database homology
`O81833`	Arabidopsis thaliana	G-type lectin S-receptor-like serine/threonine-protein kinase SD1-1	47.407%	Swiss-Prot	moderate database homology
`Q9S972`	Arabidopsis thaliana	Receptor-like serine/threonine-protein kinase SD1-6	46.022%	Swiss-Prot	moderate database homology
`Q39086`	Arabidopsis thaliana	Receptor-like serine/threonine-protein kinase SD1-7	44.920%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card