LXL04_016387 | RubberDandelionOmics

Gene overview

LXL04_016387

Reference: OH-1004 Chr: Chr03 Coordinates: 121045890-121048866 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2655 bp · LXL04_016387|LXL04_016387|OH1004|cDNA

ATGGGTGCTCGAGTCGTCTTCTTCGTAGCGATAATCGTTTTAGTTTTCTCTTTGGAAGTAGTTTCAATCAGCAATGGAAATCCCCAAAATGTTCCTCTCAACAATCTGATCAATTTGGAGGAAATTATGGATAAAGATACGGCGGAACTCGTTTGGGCGAATTGTGGAACAGAGTTGACGCATTTAATCGAAgtttttcaagatcttcatcattctAGTAGCGAGTATAAAACCCTAGAAAATGAAACGATTTTGAAATC...

CDS

Download CDS FASTA

2655 bp · LXL04_016387|LXL04_016387|OH1004|CDS

ATGGGTGCTCGAGTCGTCTTCTTCGTAGCGATAATCGTTTTAGTTTTCTCTTTGGAAGTAGTTTCAATCAGCAATGGAAATCCCCAAAATGTTCCTCTCAACAATCTGATCAATTTGGAGGAAATTATGGATAAAGATACGGCGGAACTCGTTTGGGCGAATTGTGGAACAGAGTTGACGCATTTAATCGAAGTTTTTCAAGATCTTCATCATTCTAGTAGCGAGTATAAAACCCTAGAAAATGAAACGATTTTGAAATC...

Protein

Download Protein FASTA

884 aa · LXL04_016387|LXL04_016387|OH1004|PROTEIN

MGARVVFFVAIIVLVFSLEVVSISNGNPQNVPLNNLINLEEIMDKDTAELVWANCGTELTHLIEVFQDLHHSSSEYKTLENETILKSLALQDLQVKKTILDCLSSKTIAFPESGEDNHSRKWYLDYLEYFRFGFTNSRRTRKLAEADSPSPTPTPAPSSSPAEAPTPRMPPSPPFFPAQPLDPTSGRTEQAPVAPFDNTQSNNGKNDDTHKKIIIAVVVTATTTFFLAGLMFCCYTRALAKRRQNDERPLLSLSMSDYSI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016387`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016387

Location Chr03:121045890-121048866 (+)

Description Similar to FH5: Formin-like protein 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g54650`	Might be involved in the organization and polarity of the actin cytoskeleton.	No verified direct reference in this release
`UniProt: O23373`	Acts as actin nucleation factor that directs the formation of actin cables and polarized growth in pollen tubes.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0545500`	Formin-like protein 11.	No verified direct reference in this release
`Os04g0100300`	Formin-like protein 18.	No verified direct reference in this release
`Os02g0161100`	Formin-like protein 10.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016387 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009860 pollen tube growth Biological Process

GO:0009960 endosperm development Biological Process

GO:0030036 actin cytoskeleton organization Biological Process

GO:0030041 actin filament polymerization Biological Process

GO:0045010 actin nucleation Biological Process

GO:0048317 seed morphogenesis Biological Process

GO:0051017 actin filament bundle assembly Biological Process

GO:0099636 cytoplasmic streaming Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005856 cytoskeleton Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009524 phragmoplast Cellular Component

KEGG gene cross-reference

ath:AT5G54650

dosa:Os02g0161100

dosa:Os04g0100300

dosa:Os07g0545500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.821

Rank 1 · LXL04_016387 · OH-1004

Cytoplasm0.097

Rank 2 · LXL04_016387 · OH-1004

Nucleus0.078

Rank 3 · LXL04_016387 · OH-1004

Endoplasmic reticulum0.075

Rank 4 · LXL04_016387 · OH-1004

Plastid0.032

Rank 5 · LXL04_016387 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02181.29FH2415-815 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016387	`PF02181.29`	FH2	415	815	7.6e-103	345.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94B77`	Arabidopsis thaliana	Formin-like protein 5	62.574%	Swiss-Prot	moderate database homology
`O23373`	Arabidopsis thaliana	Formin-like protein 3	61.506%	Swiss-Prot	moderate database homology
`Q0D5P3`	Oryza sativa subsp. japonica	Formin-like protein 11	54.620%	Swiss-Prot	moderate database homology
`Q6MWG9`	Oryza sativa subsp. japonica	Formin-like protein 18	55.632%	Swiss-Prot	weak database homology
`Q6H7U3`	Oryza sativa subsp. japonica	Formin-like protein 10	51.789%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card