Gene Card
Gene overview
cDNA / CDS / Protein Sequences
231 bp · LXL04_016365|LXL04_016365|OH1004|cDNA
ATGGCGACGGAGAAGAAGGAGGCAAGGATGTATCAAGTTGAGTATGACAAGCAAGTGGAGCACGAACAAAACGCTATACAGAGGCATGCGGCGAAGGCTGCTGGAACTCACTCGTATTCCATCACCGGAGCCCCGGATTGTCCCATGGGCAGCCACCAGATGTCGGCGTTGCCTGGACATGGAACGGGACAACCTGCTGGAGATGTGGTTGAAGAGAAATACAGGTCCTAG
231 bp · LXL04_016365|LXL04_016365|OH1004|CDS
ATGGCGACGGAGAAGAAGGAGGCAAGGATGTATCAAGTTGAGTATGACAAGCAAGTGGAGCACGAACAAAACGCTATACAGAGGCATGCGGCGAAGGCTGCTGGAACTCACTCGTATTCCATCACCGGAGCCCCGGATTGTCCCATGGGCAGCCACCAGATGTCGGCGTTGCCTGGACATGGAACGGGACAACCTGCTGGAGATGTGGTTGAAGAGAAATACAGGTCCTAG
Protein
Download Protein FASTA76 aa · LXL04_016365|LXL04_016365|OH1004|PROTEIN
MATEKKEARMYQVEYDKQVEHEQNAIQRHAAKAAGTHSYSITGAPDCPMGSHQMSALPGHGTGQPAGDVVEEKYRS
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_016365 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_016365 | ||||||
|---|---|---|---|---|---|---|---|
| Location | Chr03:120415326-120415556 (+) | ||||||
| Description | Similar to GMPM1: 18 kDa seed maturation protein | ||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | ||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||
| GO annotations (OH1004 source) | GO:0006970 response to osmotic stress Biological Process GO:0009409 response to cold Biological Process GO:0009414 response to water deprivation Biological Process GO:0009793 embryo development ending in seed dormancy Biological Process GO:0048316 seed development Biological Process GO:0051260 protein homooligomerization Biological Process GO:0005829 cytosol Cellular Component GO:0004460 L-lactate dehydrogenase (cytochrome) activity Molecular Function GO:0005034 osmosensor activity Molecular Function GO:0005507 copper ion binding Molecular Function GO:0008270 zinc ion binding Molecular Function GO:0016151 nickel cation binding Molecular Function | ||||||
| KEGG gene cross-reference | ath:AT5G06760 gmx:547828 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
| Protein | Organism | Description | Identity | Database | Confidence |
|---|---|---|---|---|---|
Q9FG31 | Arabidopsis thaliana | Late embryogenesis abundant protein 46 | 43.421% | Swiss-Prot | moderate database homology |