LXL04_016327 | RubberDandelionOmics

Gene overview

LXL04_016327

Reference: OH-1004 Chr: Chr03 Coordinates: 118977474-118979693 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1173 bp · LXL04_016327|LXL04_016327|OH1004|cDNA

ATGATGTGTTCTTTGAAGCAGTCTCAGCTATTGGGCTGTGGCTCCAATGTCGTCAGCCACCGGAGAAATCCCCTTGTACAACTCTCCGTTTCACCGTCGATTTCTATGCCCAAACTCCCCAATTTTGCCGTTTCCTCACTTTCTAAACCTCTACATATTTCGTCAATCGAGACACTAGGATCATCTCAATTACAACCCAAAAGGAAATCGCTGCTTACCTGCAACGCATACGAGGCTGATCAATCTGAAGAAGGAGGTGT...

CDS

Download CDS FASTA

1173 bp · LXL04_016327|LXL04_016327|OH1004|CDS

ATGATGTGTTCTTTGAAGCAGTCTCAGCTATTGGGCTGTGGCTCCAATGTCGTCAGCCACCGGAGAAATCCCCTTGTACAACTCTCCGTTTCACCGTCGATTTCTATGCCCAAACTCCCCAATTTTGCCGTTTCCTCACTTTCTAAACCTCTACATATTTCGTCAATCGAGACACTAGGATCATCTCAATTACAACCCAAAAGGAAATCGCTGCTTACCTGCAACGCATACGAGGCTGATCAATCTGAAGAAGGAGGTGT...

Protein

Download Protein FASTA

390 aa · LXL04_016327|LXL04_016327|OH1004|PROTEIN

MMCSLKQSQLLGCGSNVVSHRRNPLVQLSVSPSISMPKLPNFAVSSLSKPLHISSIETLGSSQLQPKRKSLLTCNAYEADQSEEGGVVEKAEAARKVKIGFYFATWWFLNVIFNIYNKKVLNAFPFPWLTSTLSLAAGSLIMLISWATKVAEAPKTDLDFWKSLFPVALAHTIGHVAATVSMSKVAVSFTHIIKSGEPAFSVLVSRFILGETFPMPVYLSLIPIIGGCGLAALTELNFNMTGFMGAMISNLAFVFRNIFS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016327`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016327

Location Chr03:118977474-118979693 (+)

Description Similar to GPT1: Glucose-6-phosphate/phosphate translocator 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g54800`	Glucose 6-phosphate (Glc6P) transporter.	The Arabidopsis plastidic glucose 6-phosphate/phosphate translocator GPT1 is essential for pollen maturation and embryo sac development.2005 · DOI: 10.1105/tpc.104.029124 The plastidial glucose-6-phosphate/phosphate antiporter GPT1 is essential for morphogenesis in Arabidopsis embryos.2010 · DOI: 10.1111/j.1365-313x.2010.04313.x The Arabidopsis Plastidial Glucose-6-Phosphate Transporter GPT1 is Dually Targeted to Peroxisomes via the Endoplasmic Reticulum.2020 · DOI: 10.1105/tpc.19.00959
`At1g61800`	Glucose 6-phosphate (Glc6P) transporter.	The Arabidopsis plastidic glucose 6-phosphate/phosphate translocator GPT1 is essential for pollen maturation and embryo sac development.2005 · DOI: 10.1105/tpc.104.029124 Dynamic acclimation of photosynthesis increases plant fitness in changing environments.2010 · DOI: 10.1104/pp.109.149351 The role of plastidial glucose-6-phosphate/phosphate translocators in vegetative tissues of Arabidopsis thaliana mutants impaired in starch biosynthesis.2010 · DOI: 10.1111/j.1438-8677.2010.00349.x GPT2: a glucose 6-phosphate/phosphate translocator with a novel role in the regulation of sugar signalling during seedling development.2014 · DOI: 10.1093/aob/mct298 Acclimation of metabolism to light in Arabidopsis thaliana: the glucose 6-phosphate/phosphate translocator GPT2 directs metabolic acclimation.2015 · DOI: 10.1111/pce.12495
`At5g17630`	Sugar phosphate/phosphate translocator that transports inorganic phosphate, triose phosphate, 3-phosphoglycerate, xylulose 5-phosphate (Xul-5-P) and to a lesser extent ribulose 5-phosphate.	No verified direct reference in this release
`At4g03950`	Putative glucose-6-phosphate/phosphate-translocator-like protein 1.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0239200`	Triose phosphate/phosphate translocator that may function in the export of photoassimilates from chloroplasts during the day.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016327 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007033 vacuole organization Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009624 response to nematode Biological Process

GO:0009643 photosynthetic acclimation Biological Process

GO:0009744 response to sucrose Biological Process

GO:0009749 response to glucose Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010109 regulation of photosynthesis Biological Process

GO:0010152 pollen maturation Biological Process

GO:0015713 phosphoglycerate transmembrane transport Biological Process

GO:0015714 phosphoenolpyruvate transport Biological Process

GO:0015718 monocarboxylic acid transport Biological Process

KEGG gene cross-reference

ath:AT1G61800

ath:AT4G03950

ath:AT5G17630

ath:AT5G54800

dosa:Os01g0239200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.976

Rank 1 · LXL04_016327 · OH-1004

Golgi apparatus0.034

Rank 2 · LXL04_016327 · OH-1004

Endoplasmic reticulum0.033

Rank 3 · LXL04_016327 · OH-1004

Peroxisome0.029

Rank 4 · LXL04_016327 · OH-1004

Mitochondrion0.020

Rank 5 · LXL04_016327 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03151.23TPT98-386 aa

PF00892.27EamA113-230 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016327	`PF03151.23`	TPT	98	386	6.8e-115	384.1
LXL04_016327	`PF00892.27`	EamA	113	230	6.1e-11	43.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M5A9`	Arabidopsis thaliana	Glucose-6-phosphate/phosphate translocator 1, chloroplastic	77.045%	Swiss-Prot	strong database homology
`Q94B38`	Arabidopsis thaliana	Glucose-6-phosphate/phosphate translocator 2, chloroplastic	73.879%	Swiss-Prot	strong database homology
`Q9LF61`	Arabidopsis thaliana	Xylulose 5-phosphate/phosphate translocator, chloroplastic	47.949%	Swiss-Prot	moderate database homology
`O81514`	Arabidopsis thaliana	Putative glucose-6-phosphate/phosphate-translocator-like protein 1	54.882%	Swiss-Prot	strong database homology
`Q9FTT3`	Oryza sativa subsp. japonica	Triose phosphate/phosphate translocator TPT, chloroplastic	40.606%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card