LXL04_016317 | RubberDandelionOmics

Gene overview

LXL04_016317

Reference: OH-1004 Chr: Chr03 Coordinates: 118681289-118682702 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

579 bp · LXL04_016317|LXL04_016317|OH1004|cDNA

ATGGCTTGGACGGCTTCTGGTCTAGCAAGGTCGTTCAATATGCCGGCGATTGACATCGGAGTCCTCCGCAATCGTGCTTCGATCATCGCAGGTATAGGTTGCGCCTCCGCTGTCGGCTCCAGCTTTTGGCGTTCTTCTCTACCTTCCATCACTAACCGGTCAAGTCCATTCGCTTGCCTGAGCATTTCTACTGACGCTAGTATTAAGGAAGCAGTTATAACAGACAAGGCTCCAGCAGCACTTGGTCCATATTCCCAAGC...

CDS

Download CDS FASTA

579 bp · LXL04_016317|LXL04_016317|OH1004|CDS

ATGGCTTGGACGGCTTCTGGTCTAGCAAGGTCGTTCAATATGCCGGCGATTGACATCGGAGTCCTCCGCAATCGTGCTTCGATCATCGCAGGTATAGGTTGCGCCTCCGCTGTCGGCTCCAGCTTTTGGCGTTCTTCTCTACCTTCCATCACTAACCGGTCAAGTCCATTCGCTTGCCTGAGCATTTCTACTGACGCTAGTATTAAGGAAGCAGTTATAACAGACAAGGCTCCAGCAGCACTTGGTCCATATTCCCAAGC...

Protein

Download Protein FASTA

192 aa · LXL04_016317|LXL04_016317|OH1004|PROTEIN

MAWTASGLARSFNMPAIDIGVLRNRASIIAGIGCASAVGSSFWRSSLPSITNRSSPFACLSISTDASIKEAVITDKAPAALGPYSQAIKANNTLFVSGVLGLIPETGKFVSDNVEEQTEQIMKNMGEILKASGAGYSSVVKTTIMLADLKDFKKVNEIYAKYFPAPAPARSTYQVAALPLEAKIEIECIAVL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016317`
TK1151 ID	TkA02G157070
OH-1004 ID	LXL04_016317
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016317

Location Chr03:118681289-118682702 (+)

Description Similar to RIDA: Reactive Intermediate Deaminase A, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g20390`	Hydrolyzes the Ser-derived enamine/imine product of Thr dehydratase, protecting the plastidial branched-chain aminotransferase BCAT3 (AC Q9M401) from inactivation.	Arabidopsis and maize RidA proteins preempt reactive enamine/imine damage to branched-chain amino acid biosynthesis in plastids.2014 · DOI: 10.1105/tpc.114.126854

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016317 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006402 mRNA catabolic process Biological Process

GO:0006629 lipid metabolic process Biological Process

GO:0009082 branched-chain amino acid biosynthetic process Biological Process

GO:0009097 isoleucine biosynthetic process Biological Process

GO:0009636 response to toxic substance Biological Process

GO:0017148 negative regulation of translation Biological Process

GO:0019518 L-threonine catabolic process to glycine Biological Process

GO:0033993 response to lipid Biological Process

GO:0050680 negative regulation of epithelial cell proliferation Biological Process

GO:0061157 mRNA destabilization Biological Process

GO:0070314 G1 to G0 transition Biological Process

GO:1902074 response to salt Biological Process

KEGG gene cross-reference

ath:AT3G20390

cel:CELE_C23G10.2

hsa:10247

mmu:15473

rno:65151

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.841

Rank 1 · LXL04_016317 · OH-1004

Mitochondrion0.233

Rank 2 · LXL04_016317 · OH-1004

Cytoplasm0.027

Rank 3 · LXL04_016317 · OH-1004

Nucleus0.015

Rank 4 · LXL04_016317 · OH-1004

Peroxisome0.011

Rank 5 · LXL04_016317 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01042.27Ribonuc_L-PSP75-191 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016317	`PF01042.27`	Ribonuc_L-PSP	75	191	3.1e-41	140.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94JQ4`	Arabidopsis thaliana	Reactive Intermediate Deaminase A, chloroplastic	67.692%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card