Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2432 bp · LXL04_016166|LXL04_016166|OH1004|cDNA
ATGGAGGAAGTCGACGAAACAGAAGCTGTGCCTCAGGTGTACATGGCATGCCTCATGCATGGTCATAGAGTTGGAATTTCCTACTATGATACTCTTACACGTGAACTCCATGTGCTGGAACTCTGGGAAGACGGTACCTCAGAATTTCCTCTAATTGATATGGTCAAATATCAAGTCAAACCCTTGATCATATACACAAGTACTAAGAGTGAAGAATCTCTCCTAGCTGCCTTACAACAAAATGATGATGGAAGTGAGGC...
2427 bp · LXL04_016166|LXL04_016166|OH1004|CDS
ATGGAGGAAGTCGACGAAACAGAAGCTGTGCCTCAGGTGTACATGGCATGCCTCATGCATGGTCATAGAGTTGGAATTTCCTACTATGATACTCTTACACGTGAACTCCATGTGCTGGAACTCTGGGAAGACGGTACCTCAGAATTTCCTCTAATTGATATGGTCAAATATCAAGTCAAACCCTTGATCATATACACAAGTACTAAGAGTGAAGAATCTCTCCTAGCTGCCTTACAACAAAATGATGATGGAAGTGAGGC...
Protein
Download Protein FASTA808 aa · LXL04_016166|LXL04_016166|OH1004|PROTEIN
MEEVDETEAVPQVYMACLMHGHRVGISYYDTLTRELHVLELWEDGTSEFPLIDMVKYQVKPLIIYTSTKSEESLLAALQQNDDGSEAPTVKLMKSSIFSYEQAWHRLVYLQVTGMDDGLSIKERICYLSSMMDIESEVQVRTSGGLLAILENERVVDTIEQNECGSISITIDSVMQISLNKFLKVDSAAHEALQIFQTDKHPSHMGIGRSKEGFSVFGMMNKCVTPMGKRLLRTWFLRPILDLDNLNSRLDAISFFFSSE...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_016166 |
|---|---|
| TK1151 ID | TkA02G181370 |
| OH-1004 ID | LXL04_016166 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 98.300 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 43.564Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_016166 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:112941472-112948034 (+) | ||||||||||||
| Description | Similar to MSH5: DNA mismatch repair protein MSH5 | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0000712 resolution of meiotic recombination intermediates Biological Process GO:0006298 mismatch repair Biological Process GO:0007127 meiosis I Biological Process GO:0007129 homologous chromosome pairing at meiosis Biological Process GO:0007131 reciprocal meiotic recombination Biological Process GO:0007292 female gamete generation Biological Process GO:0010777 meiotic mismatch repair involved in reciprocal meiotic recombination Biological Process GO:0045143 homologous chromosome segregation Biological Process GO:0051026 chiasma assembly Biological Process GO:0000794 condensed nuclear chromosome Cellular Component GO:0000795 synaptonemal complex Cellular Component GO:0005634 nucleus Cellular Component | ||||||||||||
| KEGG gene cross-reference | ath:AT3G20475 dosa:Os05g0498300 hsa:4439 mmu:17687 rno:294252 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF27035.1MutS5_N9-157 aaPF05192.24MutS_III189-516 aaPF00488.28MutS_V567-754 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_016166 | PF27035.1 | MutS5_N | 9 | 157 | 8.2e-16 | 58.9 |
| LXL04_016166 | PF05192.24 | MutS_III | 189 | 516 | 8.2e-32 | 111.8 |
| LXL04_016166 | PF00488.28 | MutS_V | 567 | 754 | 2.5e-46 | 158.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.