LXL04_016157 | RubberDandelionOmics

Gene overview

LXL04_016157

Reference: OH-1004 Chr: Chr03 Coordinates: 112499987-112505172 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2070 bp · LXL04_016157|LXL04_016157|OH1004|cDNA

ATGGTTAAACTCGAAAAAAAAAACTCGGGTCAAACTCGGCCAAGTTGCCCTAATTTCTATATGGGGGAGGAAGATGCGGCACCTGAAGTTGCAGAGGCAGTGCCGAATGGGACTGTCTCTCAGGACACAGCAGCCAAAGATGTGATTGAGAAAAAGGAGGAAAAGGTAGAAATAGAGGTCGAAAAGGAAGAAAAAGAGGACAAGGAAGAAAAGGAGGATAAAGATGGAGTAAAAGAGATGGATGAAGATGTCAAAGAAGA...

CDS

Download CDS FASTA

2070 bp · LXL04_016157|LXL04_016157|OH1004|CDS

ATGGTTAAACTCGAAAAAAAAAACTCGGGTCAAACTCGGCCAAGTTGCCCTAATTTCTATATGGGGGAGGAAGATGCGGCACCTGAAGTTGCAGAGGCAGTGCCGAATGGGACTGTCTCTCAGGACACAGCAGCCAAAGATGTGATTGAGAAAAAGGAGGAAAAGGTAGAAATAGAGGTCGAAAAGGAAGAAAAAGAGGACAAGGAAGAAAAGGAGGATAAAGATGGAGTAAAAGAGATGGATGAAGATGTCAAAGAAGA...

Protein

Download Protein FASTA

689 aa · LXL04_016157|LXL04_016157|OH1004|PROTEIN

MVKLEKKNSGQTRPSCPNFYMGEEDAAPEVAEAVPNGTVSQDTAAKDVIEKKEEKVEIEVEKEEKEDKEEKEDKDGVKEMDEDVKEDEKDKTKEADVDKEDAEVSKDAKKEEDEVKDAKKEEEEEVKDANKEEEEEVKDAKKEEEEEEVKDNKKEEEKEVEEEEEEKVNEEPKSEPMDVDKQEEVEEIEKEETDDKKTEVADSDMKEVEEKKEQVPEEKVSKTFSRKKSGVDKNNNTETKKETNTKASSEKKGKEKKKEP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016157`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016157

Location Chr03:112499987-112505172 (-)

Description Similar to DEK: Protein DEK

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g55660`	Chromatin-associated protein which contributes to the modulation of chromatin structure (such as super-helical structure of DNA) and function (By similarity).	No verified direct reference in this release
`At4g26630`	Chromatin-associated protein which contributes to the modulation of chromatin structure (such as super-helical structure of DNA) and function.	A DEK domain-containing protein modulates chromatin structure and function in Arabidopsis.2014 · DOI: 10.1105/tpc.114.129254
`At3g48710`	Chromatin-associated protein which contributes to the modulation of chromatin structure (such as super-helical structure of DNA) and function (By similarity).	No verified direct reference in this release
`At5g63550`	Chromatin-associated protein which contributes to the modulation of chromatin structure (such as super-helical structure of DNA) and function (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016157 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006325 chromatin organization Biological Process

GO:0006338 chromatin remodeling Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0006366 transcription by RNA polymerase II Biological Process

GO:0007165 signal transduction Biological Process

GO:0009651 response to salt stress Biological Process

GO:0019079 viral genome replication Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0045943 positive regulation of transcription by RNA polymerase I Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

KEGG gene cross-reference

ath:AT3G48710

ath:AT4G26630

ath:AT5G55660

ath:AT5G63550

hsa:7913

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.970

Rank 1 · LXL04_016157 · OH-1004

Cytoplasm0.078

Rank 2 · LXL04_016157 · OH-1004

Cell membrane0.022

Rank 3 · LXL04_016157 · OH-1004

Endoplasmic reticulum0.012

Rank 4 · LXL04_016157 · OH-1004

Extracellular0.009

Rank 5 · LXL04_016157 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08766.17DEK_C615-667 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016157	`PF08766.17`	DEK_C	615	667	9.4e-15	55.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4K4Y5`	Arabidopsis thaliana	DEK domain-containing chromatin-associated protein 4	48.980%	Swiss-Prot	moderate database homology
`Q9SUA1`	Arabidopsis thaliana	DEK domain-containing chromatin-associated protein 3	46.101%	Swiss-Prot	moderate database homology
`Q9SMM8`	Arabidopsis thaliana	DEK domain-containing chromatin-associated protein 1	37.740%	Swiss-Prot	moderate database homology
`Q84JB7`	Arabidopsis thaliana	DEK domain-containing chromatin-associated protein 2	39.952%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card