LXL04_016156 | RubberDandelionOmics

Gene overview

LXL04_016156

Reference: OH-1004 Chr: Chr03 Coordinates: 112472826-112475871 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1713 bp · LXL04_016156|LXL04_016156|OH1004|cDNA

ATGAACATTGGATTCGTAGCAGACACAGCACCATATGATTATAGTTTTACCAGTGAGTGCTTAGAGAACGCTAAGAAACCTCAATACAATGGGGGAATAGTCCTGAACCCCAAACTGAAAGAAGGTTTAAAAGGTTGGAATTCTTTCGGCAACGTAAAACTAGAAGTAAGAGTATCAGAAACTGGAAACGAATTCATAGTTTCTTATCAAAGGAATCGATCATTCGACAGTGTTTCCCAGGAATTTTTCTTGGACCATGA...

CDS

Download CDS FASTA

1713 bp · LXL04_016156|LXL04_016156|OH1004|CDS

ATGAACATTGGATTCGTAGCAGACACAGCACCATATGATTATAGTTTTACCAGTGAGTGCTTAGAGAACGCTAAGAAACCTCAATACAATGGGGGAATAGTCCTGAACCCCAAACTGAAAGAAGGTTTAAAAGGTTGGAATTCTTTCGGCAACGTAAAACTAGAAGTAAGAGTATCAGAAACTGGAAACGAATTCATAGTTTCTTATCAAAGGAATCGATCATTCGACAGTGTTTCCCAGGAATTTTTCTTGGACCATGA...

Protein

Download Protein FASTA

570 aa · LXL04_016156|LXL04_016156|OH1004|PROTEIN

MNIGFVADTAPYDYSFTSECLENAKKPQYNGGIVLNPKLKEGLKGWNSFGNVKLEVRVSETGNEFIVSYQRNRSFDSVSQEFFLDHEKLYTFSAWVQISHGDEATVVATFRTPTSFYNAGLTKAKSGCWSMLKGGLTVNQSSSSQLYFQSDNLSVDIWVDSVSLQPFSQEEWKSHQYQSIEKVRKSKVKIQAVDDEGKPLANRTLTIAQKFARFPFGCAINKNILTKQAYKDWFTSRFKYTTFENEMKWYTNERFQNQED...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016156`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016156

Location Chr03:112472826-112475871 (+)

Description Similar to XYN5: Endo-1,4-beta-xylanase 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g33810`	Binds to and hydrolyzes insoluble and soluble xylan substrates.	No verified direct reference in this release
`At4g33820`	Binds to and hydrolyzes insoluble and soluble xylan substrates.	No verified direct reference in this release
`At2g14690`	Binds to and hydrolyzes insoluble and soluble xylan substrates.	No verified direct reference in this release
`At4g08160`	Binds to and hydrolyzes insoluble and soluble xylan substrates.	No verified direct reference in this release
`At1g58370`	Binds to and hydrolyzes insoluble and soluble xylan substrates (By similarity).	A xylanase, AtXyn1, is predominantly expressed in vascular bundles, and four putative xylanase genes were identified in the Arabidopsis thaliana genome.2002 · DOI: 10.1093/pcp/pcf088

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016156 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0045493 xylan catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0031176 endo-1,4-beta-xylanase activity Molecular Function

KEGG gene cross-reference

ath:AT1G58370

ath:AT2G14690

ath:AT4G08160

ath:AT4G33810

ath:AT4G33820

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.535

Rank 1 · LXL04_016156 · OH-1004

Cytoplasm0.108

Rank 2 · LXL04_016156 · OH-1004

Lysosome / Vacuole0.097

Rank 3 · LXL04_016156 · OH-1004

Endoplasmic reticulum0.087

Rank 4 · LXL04_016156 · OH-1004

Cell membrane0.069

Rank 5 · LXL04_016156 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02018.24CBM_4_933-150 aa

PF00331.27Glyco_hydro_10213-469 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016156	`PF02018.24`	CBM_4_9	33	150	2.5e-06	28.6
LXL04_016156	`PF00331.27`	Glyco_hydro_10	213	469	2.6e-39	136.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A0A1P8B8F8`	Arabidopsis thaliana	Endo-1,4-beta-xylanase 5	41.901%	Swiss-Prot	moderate database homology
`Q84WT5`	Arabidopsis thaliana	Endo-1,4-beta-xylanase 5-like	40.741%	Swiss-Prot	moderate database homology
`Q680B7`	Arabidopsis thaliana	Endo-1,4-beta-xylanase 4	35.842%	Swiss-Prot	moderate database homology
`F4JG10`	Arabidopsis thaliana	Endo-1,4-beta-xylanase 3	28.216%	Swiss-Prot	weak database homology
`A0A1P8AWH8`	Arabidopsis thaliana	Endo-1,4-beta-xylanase 1	27.637%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card