Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1224 bp · LXL04_016127|LXL04_016127|OH1004|cDNA
ATGAACCAGGGAAGATCGTCAACACCAACCCCTAAATCATTGCTCCAATTTTCTCTCTTCAAGTCTTCCTCCCCATTGGCTAATATTATACTAAGATCAAAACCTCACCCATCAATGGCAAGAGTCGAAGAGAGACTAACCTTAAACGACGACAACCTGGGAAAACACGGGGAGTTGCTGTTGGACGGAATCTTCGACTGCTTCCATGAAATCACGGCGGCGCTCGCTTTTGCTAGGATGACCGATAACGCTTACCGTGT...
1224 bp · LXL04_016127|LXL04_016127|OH1004|CDS
ATGAACCAGGGAAGATCGTCAACACCAACCCCTAAATCATTGCTCCAATTTTCTCTCTTCAAGTCTTCCTCCCCATTGGCTAATATTATACTAAGATCAAAACCTCACCCATCAATGGCAAGAGTCGAAGAGAGACTAACCTTAAACGACGACAACCTGGGAAAACACGGGGAGTTGCTGTTGGACGGAATCTTCGACTGCTTCCATGAAATCACGGCGGCGCTCGCTTTTGCTAGGATGACCGATAACGCTTACCGTGT...
Protein
Download Protein FASTA407 aa · LXL04_016127|LXL04_016127|OH1004|PROTEIN
MNQGRSSTPTPKSLLQFSLFKSSSPLANIILRSKPHPSMARVEERLTLNDDNLGKHGELLLDGIFDCFHEITAALAFARMTDNAYRVDTTSRLAQWRIDNLASCTYRKSDPFKIGKWNWRLVIEKNRTLYIKLYPEISGLTKEPPPIASFIIRVVSSLGGRKALVHPEIRDKQLKNSEDFVWALEVPLTGKFIIDLEFLDLKTASPNGGESCSVWTEGLTQKDLKSTAISSLGKMLSESIHTDIIINASDGSMGAHRAVL...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_016127 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_016127 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:111351479-111353569 (-) | |||||||||
| Description | Similar to At1g55760: BTB/POZ domain-containing protein At1g55760 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000209 protein polyubiquitination Biological Process GO:0009651 response to salt stress Biological Process GO:0016567 protein ubiquitination Biological Process GO:0030162 regulation of proteolysis Biological Process GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0009507 chloroplast Cellular Component GO:0031463 Cul3-RING ubiquitin ligase complex Cellular Component GO:0031625 ubiquitin protein ligase binding Molecular Function GO:0042802 identical protein binding Molecular Function GO:0140678 molecular function inhibitor activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G21780 ath:AT1G55760 mmu:207213 mmu:399675 mmu:668359 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00651.38BTB234-338 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_016127 | PF00651.38 | BTB | 234 | 338 | 1e-22 | 81.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.