LXL04_015985 | RubberDandelionOmics

Gene overview

LXL04_015985

Reference: OH-1004 Chr: Chr03 Coordinates: 101640912-101644175 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1857 bp · LXL04_015985|LXL04_015985|OH1004|cDNA

ATGGGGTCTTTAGGAAATGGCGATGCCAAGAAAGCAACGTGGTTGCACCCAAGATTCACCGGCTTTAACCCTTCTGAACGATGGGGTCATTCTGCTTGCTTCTTTAATGGTTTCCTCTATGTCTTTGGTGGATGTTGTGGCGGTTTACATTTCAGTGATGTACTTGTGCTAAACCTCGAAACCATGGCTTGGACCCATCTAGCAACGACGGGAGTCGGGCCGGGTCCAAGGGACAGTCACAGCGCCGTCATCGTAGGTCA...

CDS

Download CDS FASTA

1857 bp · LXL04_015985|LXL04_015985|OH1004|CDS

ATGGGGTCTTTAGGAAATGGCGATGCCAAGAAAGCAACGTGGTTGCACCCAAGATTCACCGGCTTTAACCCTTCTGAACGATGGGGTCATTCTGCTTGCTTCTTTAATGGTTTCCTCTATGTCTTTGGTGGATGTTGTGGCGGTTTACATTTCAGTGATGTACTTGTGCTAAACCTCGAAACCATGGCTTGGACCCATCTAGCAACGACGGGAGTCGGGCCGGGTCCAAGGGACAGTCACAGCGCCGTCATCGTAGGTCA...

Protein

Download Protein FASTA

618 aa · LXL04_015985|LXL04_015985|OH1004|PROTEIN

MGSLGNGDAKKATWLHPRFTGFNPSERWGHSACFFNGFLYVFGGCCGGLHFSDVLVLNLETMAWTHLATTGVGPGPRDSHSAVIVGHMMIIFGGTNGCKKVNDVHILHLLTREWTRPNCKGVAPTPRESHTATMVGNDRMVVFGGSGEGDANYLNDLHILDLKTMRWSQPNPTGDLPVPRDSHSAVAVVNNIFIYGGDCGDRYRGDVGVFNVDTSTWSRLVVQGPSPGVRAGHAAVNIGTNVYMIGGVGDKHYYNDVWVL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015985`
TK1151 ID	TkA02G275030
OH-1004 ID	LXL04_015985
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	98.400
Protein coverage (%)	TK1151 79.750 / OH-1004 51.618 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015985

Location Chr03:101640912-101644175 (-)

Description Similar to RABEPK: Rab9 effector protein with kelch motifs

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0835800`	Acts synergistically with RAB5A and VPS9A to regulate dense vesicle-mediated post-Golgi trafficking of major storage proteins in the seed endosperm during grain filling and maturation.	GLUTELIN PRECURSOR ACCUMULATION3 encodes a regulator of post-Golgi vesicular traffic essential for vacuolar protein sorting in rice endosperm.2014 · DOI: 10.1105/tpc.113.121376

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015985 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006898 receptor-mediated endocytosis Biological Process

GO:0006904 vesicle docking involved in exocytosis Biological Process

GO:0005768 endosome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0010008 endosome membrane Cellular Component

GO:0030133 transport vesicle Cellular Component

GO:0032588 trans-Golgi network membrane Cellular Component

KEGG gene cross-reference

bta:533613

hsa:10244

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.761

Rank 1 · LXL04_015985 · OH-1004

Cytoplasm0.292

Rank 2 · LXL04_015985 · OH-1004

Cell membrane0.060

Rank 3 · LXL04_015985 · OH-1004

Endoplasmic reticulum0.035

Rank 4 · LXL04_015985 · OH-1004

Lysosome / Vacuole0.029

Rank 5 · LXL04_015985 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24681.2Kelch_KLHDC2_KLHL20_DRC78-145 aa

PF13415.13Beta-prop_FBX428-149 aa

PF24981.2Beta-prop_ATRN-LZTR19-68 aa

PF13854.13Kelch_HCF11-95 aa

PF01344.32Kelch_129-69 aa

PF07646.22Kelch_229-67 aa

PF24981.2Beta-prop_ATRN-LZTR151-197 aa

PF01344.32Kelch_176-116 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015985	`PF24681.2`	Kelch_KLHDC2_KLHL20_DRC7	8	145	1.1e-105	352.6
LXL04_015985	`PF13415.13`	Beta-prop_FBX42	8	149	4.5e-77	259.0
LXL04_015985	`PF24981.2`	Beta-prop_ATRN-LZTR1	9	68	2e-46	159.3
LXL04_015985	`PF13854.13`	Kelch_HCF	11	95	4.4e-44	151.9
LXL04_015985	`PF01344.32`	Kelch_1	29	69	1.4e-33	114.7
LXL04_015985	`PF07646.22`	Kelch_2	29	67	4.6e-26	90.1
LXL04_015985	`PF24981.2`	Beta-prop_ATRN-LZTR1	51	197	2e-46	159.3
LXL04_015985	`PF01344.32`	Kelch_1	76	116	1.4e-33	114.7
LXL04_015985	`PF24681.2`	Kelch_KLHDC2_KLHL20_DRC7	79	297	1.1e-105	352.6
LXL04_015985	`PF13854.13`	Kelch_HCF	110	197	4.4e-44	151.9
LXL04_015985	`PF13418.13`	Beta-prop_TYW4	124	351	3.7e-19	70.3
LXL04_015985	`PF25210.2`	Kelch_FKB95	128	221	4e-19	70.0
LXL04_015985	`PF13415.13`	Beta-prop_FBX42	129	315	4.5e-77	259.0
LXL04_015985	`PF07646.22`	Kelch_2	130	172	4.6e-26	90.1
LXL04_015985	`PF13854.13`	Kelch_HCF	152	247	4.4e-44	151.9
LXL04_015985	`PF24981.2`	Beta-prop_ATRN-LZTR1	192	273	2e-46	159.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q10AZ7`	Oryza sativa subsp. japonica	Protein GLUTELIN PRECURSOR ACCUMULATION 3	30.667%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card