LXL04_015947 | RubberDandelionOmics

Gene overview

LXL04_015947

Reference: OH-1004 Chr: Chr03 Coordinates: 99888017-99889634 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

672 bp · LXL04_015947|LXL04_015947|OH1004|cDNA

ATGGCGATCTTCACACTTCAAACGCTAACCACCCCATCTCTCCACCATACCGTTCAACTCTCCTCCACCAGGCCACACCAGAACGGCACCATCATTAAGTCGCATTCGAATTCGAAATGTTCTATAGACCCGACAAATAATCTCACTCCTAATCCCAACAACAAGAGGAGATTAGTTGGTGTAGGTATTGGATTGTTAGCTGCTTCGATGCTAATCTCATCCCCGCTCGATGCTAATGCTACTAGAATCGAGTATTACGC...

CDS

Download CDS FASTA

672 bp · LXL04_015947|LXL04_015947|OH1004|CDS

ATGGCGATCTTCACACTTCAAACGCTAACCACCCCATCTCTCCACCATACCGTTCAACTCTCCTCCACCAGGCCACACCAGAACGGCACCATCATTAAGTCGCATTCGAATTCGAAATGTTCTATAGACCCGACAAATAATCTCACTCCTAATCCCAACAACAAGAGGAGATTAGTTGGTGTAGGTATTGGATTGTTAGCTGCTTCGATGCTAATCTCATCCCCGCTCGATGCTAATGCTACTAGAATCGAGTATTACGC...

Protein

Download Protein FASTA

223 aa · LXL04_015947|LXL04_015947|OH1004|PROTEIN

MAIFTLQTLTTPSLHHTVQLSSTRPHQNGTIIKSHSNSKCSIDPTNNLTPNPNNKRRLVGVGIGLLAASMLISSPLDANATRIEYYATVAEPSCELQFAPSGLGYCDVAPGFGEEAPYSTLINIHYTARFADGIVFDSSYKRGRPLTMRIGVGKVIKGLDQGIFGGEGVPPMLVGGRRRLQIPPELAYGPEPAGCFSGECNIPANATLLYDINFVNMYSGNRK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015947`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015947

Location Chr03:99888017-99889634 (+)

Description Similar to PNSL4: Photosynthetic NDH subunit of lumenal location 4, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g39710`	NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain.	Efficient operation of NAD(P)H dehydrogenase requires supercomplex formation with photosystem I via minor LHCI in Arabidopsis.2009 · DOI: 10.1105/tpc.109.068791
`At5g45680`	PPIases accelerate the folding of proteins.	Profound redox sensitivity of peptidyl-prolyl isomerase activity in Arabidopsis thylakoid lumen.2006 · DOI: 10.1016/j.febslet.2006.05.054 Immunophilin AtFKBP13 sustains all peptidyl-prolyl isomerase activity in the thylakoid lumen from Arabidopsis thaliana deficient in AtCYP20-2.2007 · DOI: 10.1021/bi700426q Peptidyl-prolyl isomerase activity in chloroplast thylakoid lumen is a dispensable function of immunophilins in Arabidopsis thaliana.2009 · DOI: 10.1093/pcp/pcp122

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015947 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005576 extracellular region Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0009543 chloroplast thylakoid lumen Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0031977 thylakoid lumen Cellular Component

GO:0003755 peptidyl-prolyl cis-trans isomerase activity Molecular Function

KEGG gene cross-reference

ath:AT4G39710

ath:AT5G45680

nma:NMA0273

nme:NMB0027

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.980

Rank 1 · LXL04_015947 · OH-1004

Mitochondrion0.025

Rank 2 · LXL04_015947 · OH-1004

Nucleus0.014

Rank 3 · LXL04_015947 · OH-1004

Cytoplasm0.011

Rank 4 · LXL04_015947 · OH-1004

Cell membrane0.009

Rank 5 · LXL04_015947 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00254.35FKBP_C119-213 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015947	`PF00254.35`	FKBP_C	119	213	1.6e-23	83.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SCY3`	Arabidopsis thaliana	Photosynthetic NDH subunit of lumenal location 4, chloroplastic	71.429%	Swiss-Prot	strong database homology
`Q9SCY2`	Arabidopsis thaliana	Peptidyl-prolyl cis-trans isomerase FKBP13, chloroplastic	40.376%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card