Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3505 bp · LXL04_015774|LXL04_015774|OH1004|cDNA
ATGCATTTCAGGTTAGGGTTTCTGTTGACATCCAATCTCAGAAGGAAATCTCCACTGTCTACTTTCTTCACACACAACACTTCCTCAACAAGTAGCGTGCTTGGTTATTCTCTGGTACTACATCGGCGTTCTTCAAGCATCAACCATGGAGGTCCCTTTTCCCGGTTACTTTCATCGAGTTTGCACTATGGAGGAGCACGTTATCTTAGCGGCTACGCAGTTGATCAGTTCTCGGACGACGAGTACGAATGTGATTACGA...
3498 bp · LXL04_015774|LXL04_015774|OH1004|CDS
ATGCATTTCAGGTTAGGGTTTCTGTTGACATCCAATCTCAGAAGGAAATCTCCACTGTCTACTTTCTTCACACACAACACTTCCTCAACAAGTAGCGTGCTTGGTTATTCTCTGGTACTACATCGGCGTTCTTCAAGCATCAACCATGGAGGTCCCTTTTCCCGGTTACTTTCATCGAGTTTGCACTATGGAGGAGCACGTTATCTTAGCGGCTACGCAGTTGATCAGTTCTCGGACGACGAGTACGAATGTGATTACGA...
Protein
Download Protein FASTA1165 aa · LXL04_015774|LXL04_015774|OH1004|PROTEIN
MHFRLGFLLTSNLRRKSPLSTFFTHNTSSTSSVLGYSLVLHRRSSSINHGGPFSRLLSSSLHYGGARYLSGYAVDQFSDDEYECDYETNPASSSVANIDEWKWKLSMLLHSKTEQEIVTRDKRDKRDYEQIYNLAKKMGLYWYELYGKVVVASKVPLPHYRPDLDDKRPQREVVIPLSLQRRVEGLLQEHLDRMQSIKASSSTSESSHHAELANRGGNGSSDPLVDGSLMEKVLQRRSLQMRNMQRSWEESPEGKKMLQG...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_015774 |
|---|---|
| TK1151 ID | TkA02G287240 |
| OH-1004 ID | LXL04_015774 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.500 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_015774 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:83917579-83923581 (+) | ||||||||||||
| Description | Similar to At1g48650: DExH-box ATP-dependent RNA helicase DExH3 | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0001503 ossification Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006359 regulation of transcription by RNA polymerase III Biological Process GO:0007283 spermatogenesis Biological Process GO:0009615 response to virus Biological Process GO:0010628 positive regulation of gene expression Biological Process GO:0017148 negative regulation of translation Biological Process GO:0030154 cell differentiation Biological Process GO:0031442 positive regulation of mRNA 3'-end processing Biological Process GO:0032206 positive regulation of telomere maintenance Biological Process GO:0034605 cellular response to heat Biological Process GO:0034644 cellular response to UV Biological Process | ||||||||||||
| KEGG gene cross-reference | ath:AT1G48650 ath:AT2G01130 ath:AT2G35920 mmu:72162 rno:310461 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF27261.1DEXH1_3_5_N99-171 aaPF00270.36DEAD272-426 aaPF00271.38Helicase_C533-662 aaPF04408.30WHD_HA2726-754 aaPF21010.3HA2_C755-815 aaPF07717.23OB_NTP_bind882-962 aaPF26026.1RNA_hel_CTD972-1030 aaPF00035.33dsrm1063-1122 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_015774 | PF27261.1 | DEXH1_3_5_N | 99 | 171 | 6.2e-31 | 107.1 |
| LXL04_015774 | PF00270.36 | DEAD | 272 | 426 | 8.2e-10 | 39.4 |
| LXL04_015774 | PF00271.38 | Helicase_C | 533 | 662 | 5.1e-12 | 46.7 |
| LXL04_015774 | PF04408.30 | WHD_HA2 | 726 | 754 | 1.4e-07 | 32.1 |
| LXL04_015774 | PF21010.3 | HA2_C | 755 | 815 | 5.1e-16 | 59.7 |
| LXL04_015774 | PF07717.23 | OB_NTP_bind | 882 | 962 | 1.2e-16 | 61.4 |
| LXL04_015774 | PF26026.1 | RNA_hel_CTD | 972 | 1030 | 6.6e-24 | 84.2 |
| LXL04_015774 | PF00035.33 | dsrm | 1063 | 1122 | 3.8e-07 | 31.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
| Protein | Organism | Description | Identity | Database | Confidence |
|---|---|---|---|---|---|
F4HYJ7 | Arabidopsis thaliana | DExH-box ATP-dependent RNA helicase DExH3 | 61.948% | Swiss-Prot | strong database homology |
F4IM84 | Arabidopsis thaliana | DExH-box ATP-dependent RNA helicase DExH5, mitochondrial | 59.259% | Swiss-Prot | strong database homology |
F4ILR7 | Arabidopsis thaliana | DExH-box ATP-dependent RNA helicase DExH1 | 48.993% | Swiss-Prot | moderate database homology |