LXL04_015674 | RubberDandelionOmics

Gene overview

LXL04_015674

Reference: OH-1004 Chr: Chr03 Coordinates: 80020243-80022506 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1401 bp · LXL04_015674|LXL04_015674|OH1004|cDNA

ATGGATGTGCGTGATAAGCTTCTTTTTGAAGCAGACTATGTTGGTAATGTTAGGGAAAAGGTCCCACCAAAATCATCTCTTCAAATTCCATGGTCCTGGTTGCTTGGTGCACTTTCCCTCTTACAAGAGAACAACACTACAACACTACAACACCCTGATTCCAAGCCTTTTGTCCATGATTTGCTTTTATCAATGGCTCTTGCAGAGTGTGCTATAGCAAAATCAAACTTTGAAAAGAACAAGATTTCTCAAAGATTTGA...

CDS

Download CDS FASTA

1401 bp · LXL04_015674|LXL04_015674|OH1004|CDS

ATGGATGTGCGTGATAAGCTTCTTTTTGAAGCAGACTATGTTGGTAATGTTAGGGAAAAGGTCCCACCAAAATCATCTCTTCAAATTCCATGGTCCTGGTTGCTTGGTGCACTTTCCCTCTTACAAGAGAACAACACTACAACACTACAACACCCTGATTCCAAGCCTTTTGTCCATGATTTGCTTTTATCAATGGCTCTTGCAGAGTGTGCTATAGCAAAATCAAACTTTGAAAAGAACAAGATTTCTCAAAGATTTGA...

Protein

Download Protein FASTA

466 aa · LXL04_015674|LXL04_015674|OH1004|PROTEIN

MDVRDKLLFEADYVGNVREKVPPKSSLQIPWSWLLGALSLLQENNTTTLQHPDSKPFVHDLLLSMALAECAIAKSNFEKNKISQRFEALARAQSLLKSKPSLEQMTLLSQIEESLEELAPACTLELLGMPHSQENAERRVGAIAALRELLRQGLDVDSQCQIDDWSNFLNQALNKLTAAEITELLTWDSLVNTRKNKKSLESQNQRTVIDASCLYTVMMAHIALGFSSKQIEMINKGKSICECLVASEGIDLKLEEAFCL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015674`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015674

Location Chr03:80020243-80022506 (+)

Description Similar to CDP1: Plastid division protein CDP1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g19180`	Component of the plastid division machinery required for PDV1 localization to constriction sites.	PARC6, a novel chloroplast division factor, influences FtsZ assembly and is required for recruitment of PDV1 during chloroplast division in Arabidopsis.2009 · DOI: 10.1111/j.1365-313x.2009.03905.x CDP1, a novel component of chloroplast division site positioning system in Arabidopsis.2009 · DOI: 10.1038/cr.2009.78 The chloroplast min system functions differentially in two specific nongreen plastids in Arabidopsis thaliana.2013 · DOI: 10.1371/journal.pone.0071190 Roles of Arabidopsis PARC6 in Coordination of the Chloroplast Division Complex and Negative Regulation of FtsZ Assembly.2016 · DOI: 10.1104/pp.15.01460 Isolation and analysis of a stromule-overproducing Arabidopsis mutant suggest the role of PARC6 in plastid morphology maintenance in the leaf epidermis.2018 · DOI: 10.1111/ppl.12648 ARC3 Activation by PARC6 Promotes FtsZ-Ring Remodeling at the Chloroplast Division Site.2019 · DOI: 10.1105/tpc.18.00948
`At5g42480`	Component of the plastid division machinery consisting in a binary fission accomplished by the simultaneous constriction of the FtsZ ring on the stromal side of the inner envelope membrane, and the ARC5 ring on the cytosolic side of the outer envelope membrane.	The distinctive roles of five different ARC genes in the chloroplast division process in Arabidopsis.1999 · DOI: 10.1046/j.1365-313x.1999.00500.x Reduced gravitropism in inflorescence stems and hypocotyls, but not roots, of Arabidopsis mutants with large plastids.2002 · DOI: 10.1034/j.1399-3054.2002.1140417.x arc6, A Fertile Arabidopsis Mutant with Only Two Mesophyll Cell Chloroplasts.1994 · DOI: 10.1104/pp.106.3.1169 ARC6 is a J-domain plastid division protein and an evolutionary descendant of the cyanobacterial cell division protein Ftn2.2003 · DOI: 10.1105/tpc.013292 Effects of arc3, arc5 and arc6 mutations on plastid morphology and stromule formation in green and nongreen tissues of Arabidopsis thaliana.2008 · DOI: 10.1111/j.1751-1097.2008.00437.x Arabidopsis ARC6 coordinates the division machineries of the inner and outer chloroplast membranes through interaction with PDV2 in the intermembrane space.2008 · DOI: 10.1105/tpc.108.061440 The Arabidopsis arc5 and arc6 mutations differentially affect plastid morphology in pavement and guard cells in the leaf epidermis.2018 · DOI: 10.1371/journal.pone.0192380 MCD1 Associates with FtsZ Filaments via the Membrane-Tethering Protein ARC6 to Guide Chloroplast Division.2018 · DOI: 10.1105/tpc.18.00189 arc6, an extreme chloroplast division mutant of Arabidopsis also alters proplastid proliferation and morphology in shoot and root apices.1995 · DOI: 10.1242/jcs.108.9.2937 Plastid ontogeny during petal development in Arabidopsis.1998 · DOI: 10.1104/pp.116.2.797

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015674 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009658 chloroplast organization Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0010020 chloroplast fission Biological Process

GO:0043572 plastid fission Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009528 plastid inner membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0009706 chloroplast inner membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0042803 protein homodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT3G19180

ath:AT5G42480

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.494

Rank 1 · LXL04_015674 · OH-1004

Nucleus0.375

Rank 2 · LXL04_015674 · OH-1004

Mitochondrion0.103

Rank 3 · LXL04_015674 · OH-1004

Cell membrane0.095

Rank 4 · LXL04_015674 · OH-1004

Golgi apparatus0.077

Rank 5 · LXL04_015674 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25515.2Arm_PDR28-165 aa

PF23468.2ARC6204-342 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015674	`PF25515.2`	Arm_PDR	28	165	5.8e-36	124.5
LXL04_015674	`PF23468.2`	ARC6	204	342	1.6e-08	34.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VY16`	Arabidopsis thaliana	Plastid division protein CDP1, chloroplastic	56.030%	Swiss-Prot	strong database homology
`Q9FIG9`	Arabidopsis thaliana	Protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 6, chloroplastic	25.291%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card