Gene Card
Gene overview
cDNA / CDS / Protein Sequences
903 bp · LXL04_015649|LXL04_015649|OH1004|cDNA
ATGGCAAAGTGCTTCAGCTTCACAGCATCACGAGACCGGTGTTTCCGATACTCCTTCAGCCGCACCGGCCTCAAATCCACCACCATCAACCTCCACGACGGCGCCACCGTCATCCATTTCTGGATCCCCAAAACCCCCAAACCCAGCAAACCCAATCTCCTCCTCATCCACGGCTTCGGCGCCAACGCAATGTGGCAGTACAACGACTTCCTCTCCCCACTCGTTTCCAAGTTCAACGTATACATCCCGGACCTCCTATT...
903 bp · LXL04_015649|LXL04_015649|OH1004|CDS
ATGGCAAAGTGCTTCAGCTTCACAGCATCACGAGACCGGTGTTTCCGATACTCCTTCAGCCGCACCGGCCTCAAATCCACCACCATCAACCTCCACGACGGCGCCACCGTCATCCATTTCTGGATCCCCAAAACCCCCAAACCCAGCAAACCCAATCTCCTCCTCATCCACGGCTTCGGCGCCAACGCAATGTGGCAGTACAACGACTTCCTCTCCCCACTCGTTTCCAAGTTCAACGTATACATCCCGGACCTCCTATT...
Protein
Download Protein FASTA300 aa · LXL04_015649|LXL04_015649|OH1004|PROTEIN
MAKCFSFTASRDRCFRYSFSRTGLKSTTINLHDGATVIHFWIPKTPKPSKPNLLLIHGFGANAMWQYNDFLSPLVSKFNVYIPDLLFFGESHTTRPERTEHFQAECLMAAMEAVGVTGKMNVMGLSYGGFVGYSMASKFPEKVEKVVIAGSGVCVEESDMEKGLLTVKSIDDASSILLAQTPEKLRELMKVAFFKPPVNVPSCFLSDFIDVMNTEYVQERRELIETLYKGRKFSNLPKIIQPTMIIWGEHDRIFPLELGE...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_015649 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_015649 |
|---|---|
| Location | Chr03:78972516-78974927 (-) |
| Description | Similar to lip3: Lipase 3 (Moraxella sp. (strain TA144) |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0009395 phospholipid catabolic process Biological Process GO:0046464 acylglycerol catabolic process Biological Process GO:0046889 positive regulation of lipid biosynthetic process Biological Process GO:0052651 monoacylglycerol catabolic process Biological Process GO:0120163 negative regulation of cold-induced thermogenesis Biological Process GO:2001311 lysobisphosphatidic acid metabolic process Biological Process GO:0005765 lysosomal membrane Cellular Component GO:0005886 plasma membrane Cellular Component GO:0016020 membrane Cellular Component GO:0031902 late endosome membrane Cellular Component GO:0031966 mitochondrial membrane Cellular Component GO:0004620 glycerophospholipase activity Molecular Function |
| KEGG gene cross-reference | bta:505283 xla:380544 xla:444738 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF12146.16Hydrolase_450-158 aaPF00561.27Abhydrolase_151-184 aaPF12697.14Abhydrolase_653-290 aaPF00561.27Abhydrolase_1223-287 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_015649 | PF12146.16 | Hydrolase_4 | 50 | 158 | 5.1e-09 | 36.5 |
| LXL04_015649 | PF00561.27 | Abhydrolase_1 | 51 | 184 | 1.4e-24 | 87.8 |
| LXL04_015649 | PF12697.14 | Abhydrolase_6 | 53 | 290 | 3.1e-15 | 58.1 |
| LXL04_015649 | PF00561.27 | Abhydrolase_1 | 223 | 287 | 1.4e-24 | 87.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.