LXL04_015647 | RubberDandelionOmics

Gene overview

LXL04_015647

Reference: OH-1004 Chr: Chr03 Coordinates: 78843344-78843766 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

357 bp · LXL04_015647|LXL04_015647|OH1004|cDNA

ATGGCCATGAATTCACTTCAAGCAATCATTATCTCCATCTTAATCACTCTCCATCTTCTCTCTCTGTCTTCTAATTGCTCTCGTCTTCATATGAGTCTTTCAAAAACCACCCACATCCGGGGTTTATTATATGAAGAGAAAACCAGGCTGGGTTCAACGCCGCCTAGCTGTCACAACAAGTGCAACCTCTGCCACCCATGCATGGCGGTGCAGGTGCCGACGATACCGGGTCACAGCCGAGTTCAACCGGCGGACTACTA...

CDS

Download CDS FASTA

357 bp · LXL04_015647|LXL04_015647|OH1004|CDS

ATGGCCATGAATTCACTTCAAGCAATCATTATCTCCATCTTAATCACTCTCCATCTTCTCTCTCTGTCTTCTAATTGCTCTCGTCTTCATATGAGTCTTTCAAAAACCACCCACATCCGGGGTTTATTATATGAAGAGAAAACCAGGCTGGGTTCAACGCCGCCTAGCTGTCACAACAAGTGCAACCTCTGCCACCCATGCATGGCGGTGCAGGTGCCGACGATACCGGGTCACAGCCGAGTTCAACCGGCGGACTACTA...

Protein

Download Protein FASTA

118 aa · LXL04_015647|LXL04_015647|OH1004|PROTEIN

MAMNSLQAIIISILITLHLLSLSSNCSRLHMSLSKTTHIRGLLYEEKTRLGSTPPSCHNKCNLCHPCMAVQVPTIPGHSRVQPADYYDQPPASSSGNRYSNYKPLGWKCRCGGHLYNP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015647`
TK1151 ID	TkA02G307900
OH-1004 ID	LXL04_015647
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015647

Location Chr03:78843344-78843766 (+)

Description Similar to EPFL1: EPIDERMAL PATTERNING FACTOR-like protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g10310`	Controls stomatal patterning.	No verified direct reference in this release
`At3g13898`	Controls stomatal patterning.	No verified direct reference in this release
`At4g14723`	Acts primarily as positive regulator of inflorescence growth.	Generation of signaling specificity in Arabidopsis by spatially restricted buffering of ligand-receptor interactions.2011 · DOI: 10.1105/tpc.111.086637 Regulation of inflorescence architecture by intertissue layer ligand-receptor communication between endodermis and phloem.2012 · DOI: 10.1073/pnas.1117537109 Regulation of plant vascular stem cells by endodermis-derived EPFL-family peptide hormones and phloem-expressed ERECTA-family receptor kinases.2013 · DOI: 10.1093/jxb/ert196
`At4g37810`	Controls stomatal patterning.	No verified direct reference in this release
`At2g30370`	Acts primarily as positive regulator of inflorescence growth.	Regional specification of stomatal production by the putative ligand CHALLAH.2010 · DOI: 10.1242/dev.040931 Generation of signaling specificity in Arabidopsis by spatially restricted buffering of ligand-receptor interactions.2011 · DOI: 10.1105/tpc.111.086637 Regulation of inflorescence architecture by intertissue layer ligand-receptor communication between endodermis and phloem.2012 · DOI: 10.1073/pnas.1117537109 Regulation of plant vascular stem cells by endodermis-derived EPFL-family peptide hormones and phloem-expressed ERECTA-family receptor kinases.2013 · DOI: 10.1093/jxb/ert196

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015647 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007267 cell-cell signaling Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0010052 guard cell differentiation Biological Process

GO:0010374 stomatal complex development Biological Process

GO:0048481 plant ovule development Biological Process

GO:0080086 stamen filament development Biological Process

GO:2000122 negative regulation of stomatal complex development Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0048018 receptor ligand activity Molecular Function

KEGG gene cross-reference

ath:AT2G30370

ath:AT3G13898

ath:AT4G14723

ath:AT4G37810

ath:AT5G10310

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.693

Rank 1 · LXL04_015647 · OH-1004

Cell membrane0.124

Rank 2 · LXL04_015647 · OH-1004

Endoplasmic reticulum0.090

Rank 3 · LXL04_015647 · OH-1004

Cytoplasm0.061

Rank 4 · LXL04_015647 · OH-1004

Golgi apparatus0.054

Rank 5 · LXL04_015647 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17181.10EPF49-118 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015647	`PF17181.10`	EPF	49	118	2.4e-21	76.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LFT5`	Arabidopsis thaliana	EPIDERMAL PATTERNING FACTOR-like protein 1	58.537%	Swiss-Prot	moderate database homology
`C4B8C4`	Arabidopsis thaliana	EPIDERMAL PATTERNING FACTOR-like protein 3	37.681%	Swiss-Prot	moderate database homology
`Q2V3I3`	Arabidopsis thaliana	EPIDERMAL PATTERNING FACTOR-like protein 4	33.645%	Swiss-Prot	moderate database homology
`Q9T068`	Arabidopsis thaliana	EPIDERMAL PATTERNING FACTOR-like protein 2	36.842%	Swiss-Prot	moderate database homology
`Q1PEY6`	Arabidopsis thaliana	EPIDERMAL PATTERNING FACTOR-like protein 6	36.471%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card