LXL04_015463 | RubberDandelionOmics

Gene overview

LXL04_015463

Reference: OH-1004 Chr: Chr03 Coordinates: 72841764-72842789 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

585 bp · LXL04_015463|LXL04_015463|OH1004|cDNA

ATGAAGACTATTTTGTCATCGGAGACCATGGACATCCCTGAGGGCGTTGAGATAAAAATCAAGGCCAAGGTTATCGAGGTTACAGGGCCAAGAGGAACACTCACTCGCAATTTCAAGCATCTCAACCTTGATTTCCAGCTTATCACTGATGAAGAGACCGGAAACCAGAAGCTCAAGGTCGATGCTTGGTTTGGATCTCGGAAGACCACCGCCTCCATCCGTACCGCCCTCAGTCACGTTAATAATCTTATCATCGGCGT...

CDS

Download CDS FASTA

585 bp · LXL04_015463|LXL04_015463|OH1004|CDS

ATGAAGACTATTTTGTCATCGGAGACCATGGACATCCCTGAGGGCGTTGAGATAAAAATCAAGGCCAAGGTTATCGAGGTTACAGGGCCAAGAGGAACACTCACTCGCAATTTCAAGCATCTCAACCTTGATTTCCAGCTTATCACTGATGAAGAGACCGGAAACCAGAAGCTCAAGGTCGATGCTTGGTTTGGATCTCGGAAGACCACCGCCTCCATCCGTACCGCCCTCAGTCACGTTAATAATCTTATCATCGGCGT...

Protein

Download Protein FASTA

194 aa · LXL04_015463|LXL04_015463|OH1004|PROTEIN

MKTILSSETMDIPEGVEIKIKAKVIEVTGPRGTLTRNFKHLNLDFQLITDEETGNQKLKVDAWFGSRKTTASIRTALSHVNNLIIGVTQGFRYKMRFVYAHFPINASISNTNKAIEIRNFLGEKKVRKVDMLDGVTVVRSEKVKDELILDGNDIELVSRSCALINQKCHVKNKDIRKFLDGIYVSDKAKIEEEN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015463`
TK1151 ID	TkA02G329030
OH-1004 ID	LXL04_015463
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	97.600
Protein coverage (%)	TK1151 100.000 / OH-1004 64.433 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015463

Location Chr03:72841764-72842789 (+)

Description Similar to RPL9B: 60S ribosomal protein L9-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: P49209`	Large ribosomal subunit protein uL6z/uL6y.	No verified direct reference in this release
`At4g10450`	Large ribosomal subunit protein uL6x.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0485900`	Large ribosomal subunit protein uL6.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015463 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002181 cytoplasmic translation Biological Process

GO:0006412 translation Biological Process

GO:0006941 striated muscle contraction Biological Process

GO:0007283 spermatogenesis Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005840 ribosome Cellular Component

KEGG gene cross-reference

ath:AT1G33120

ath:AT1G33140

ath:AT4G10450

dosa:Os09g0485900

mmu:20005

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.810

Rank 1 · LXL04_015463 · OH-1004

Nucleus0.219

Rank 2 · LXL04_015463 · OH-1004

Mitochondrion0.083

Rank 3 · LXL04_015463 · OH-1004

Endoplasmic reticulum0.061

Rank 4 · LXL04_015463 · OH-1004

Cell membrane0.057

Rank 5 · LXL04_015463 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00347.29Ribosomal_L612-90 aa

PF00347.29Ribosomal_L6102-181 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015463	`PF00347.29`	Ribosomal_L6	12	90	1.9e-26	93.4
LXL04_015463	`PF00347.29`	Ribosomal_L6	102	181	1.9e-26	93.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P49209`	Arabidopsis thaliana	Large ribosomal subunit protein uL6z/uL6y	82.902%	Swiss-Prot	strong database homology
`Q9SZX9`	Arabidopsis thaliana	Large ribosomal subunit protein uL6x	82.383%	Swiss-Prot	strong database homology
`P49210`	Oryza sativa subsp. japonica	Large ribosomal subunit protein uL6	78.756%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card