LXL04_015381 | RubberDandelionOmics

Gene overview

LXL04_015381

Reference: OH-1004 Chr: Chr03 Coordinates: 70185798-70186241 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

444 bp · LXL04_015381|LXL04_015381|OH1004|cDNA

ATGTGTCCGACCGGAACTTCCCTATGGCCTGCAAGAGACATTTCCGACCTACGCTCTGCATTTGAGGTGCTCGACGCCGATCATGACGGAAAGATCAGCCGTGAAGATCTAAAGACGTCTTATGCAGACGCTGACGATGCGGTCATCGGCACCATGATGACGGTGGCCGATTCTAACAACGATGGTTACGTTGAGTACGATGAGTTCGAGAAAGTATTGAATAGTGATAACAGAGGCAGTAACGGCGTGATGAAGGATAT...

CDS

Download CDS FASTA

444 bp · LXL04_015381|LXL04_015381|OH1004|CDS

ATGTGTCCGACCGGAACTTCCCTATGGCCTGCAAGAGACATTTCCGACCTACGCTCTGCATTTGAGGTGCTCGACGCCGATCATGACGGAAAGATCAGCCGTGAAGATCTAAAGACGTCTTATGCAGACGCTGACGATGCGGTCATCGGCACCATGATGACGGTGGCCGATTCTAACAACGATGGTTACGTTGAGTACGATGAGTTCGAGAAAGTATTGAATAGTGATAACAGAGGCAGTAACGGCGTGATGAAGGATAT...

Protein

Download Protein FASTA

147 aa · LXL04_015381|LXL04_015381|OH1004|PROTEIN

MCPTGTSLWPARDISDLRSAFEVLDADHDGKISREDLKTSYADADDAVIGTMMTVADSNNDGYVEYDEFEKVLNSDNRGSNGVMKDMFKSMDRDGDGKVGFGDLTSYLSSAGFEVNDDEIKAMLGLGGVDGEADGVTFDEFLKILAV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015381`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015381

Location Chr03:70185798-70186241 (-)

Description Similar to CP1: Calcium-binding protein CP1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g49480`	Binds calcium in vitro.	No verified direct reference in this release
`At2g43290`	Potential calcium sensor.	No verified direct reference in this release
`At4g14640`	Potential calcium sensor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os11g0586200`	Potential calcium sensor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015381 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005513 detection of calcium ion Biological Process

GO:0009617 response to bacterium Biological Process

GO:0019722 calcium-mediated signaling Biological Process

GO:0042538 hyperosmotic salinity response Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0010008 endosome membrane Cellular Component

GO:0012505 endomembrane system Cellular Component

GO:0005509 calcium ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G43290

ath:AT4G14640

ath:AT5G49480

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.531

Rank 1 · LXL04_015381 · OH-1004

Nucleus0.264

Rank 2 · LXL04_015381 · OH-1004

Plastid0.106

Rank 3 · LXL04_015381 · OH-1004

Peroxisome0.105

Rank 4 · LXL04_015381 · OH-1004

Cell membrane0.085

Rank 5 · LXL04_015381 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13499.13EF-hand_715-72 aa

PF00036.39EF-hand_116-39 aa

PF13405.13EF-hand_616-38 aa

PF13202.13EF-hand_517-39 aa

PF13833.13EF-hand_828-69 aa

PF00036.39EF-hand_151-74 aa

PF13499.13EF-hand_784-144 aa

PF00036.39EF-hand_184-109 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015381	`PF13499.13`	EF-hand_7	15	72	1.1e-20	74.5
LXL04_015381	`PF00036.39`	EF-hand_1	16	39	1.6e-20	71.8
LXL04_015381	`PF13405.13`	EF-hand_6	16	38	1.2e-17	62.6
LXL04_015381	`PF13202.13`	EF-hand_5	17	39	1.8e-15	56.3
LXL04_015381	`PF13833.13`	EF-hand_8	28	69	1.1e-10	41.8
LXL04_015381	`PF00036.39`	EF-hand_1	51	74	1.6e-20	71.8
LXL04_015381	`PF13499.13`	EF-hand_7	84	144	1.1e-20	74.5
LXL04_015381	`PF00036.39`	EF-hand_1	84	109	1.6e-20	71.8
LXL04_015381	`PF13405.13`	EF-hand_6	84	112	1.2e-17	62.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FDX6`	Arabidopsis thaliana	Calcium-binding protein CP1	50.932%	Swiss-Prot	strong database homology
`O22845`	Arabidopsis thaliana	Calmodulin-like protein 5	33.333%	Swiss-Prot	moderate database homology
`O23320`	Arabidopsis thaliana	Calmodulin-like protein 8	27.536%	Swiss-Prot	weak database homology
`Q2R1Z5`	Oryza sativa subsp. japonica	Putative calmodulin-like protein 6	29.861%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card