Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1926 bp · LXL04_015363|LXL04_015363|OH1004|cDNA
ATGGCGCCCATACCTCTCTTGGTGACGGCAACGAAGCTCGCCGGAGTGTTAGCGACTATCACGGTAGCCGCCAACGCCGTCTCCTTCTCCCGTTTCCGGAAGAGAAATCTCGCACCATTTGACTCCCCTATCGATGAAACCTCCGACACTCTCGCCATCTTCAACGTAAATTGCTCTGACTCTGACGATGAAGAAGAGGAAGGTTTCTTTTTCGGGCTAGCAACAGCACCAGCTCATGTTGAAGATGGGCTCAATGATGC...
1926 bp · LXL04_015363|LXL04_015363|OH1004|CDS
ATGGCGCCCATACCTCTCTTGGTGACGGCAACGAAGCTCGCCGGAGTGTTAGCGACTATCACGGTAGCCGCCAACGCCGTCTCCTTCTCCCGTTTCCGGAAGAGAAATCTCGCACCATTTGACTCCCCTATCGATGAAACCTCCGACACTCTCGCCATCTTCAACGTAAATTGCTCTGACTCTGACGATGAAGAAGAGGAAGGTTTCTTTTTCGGGCTAGCAACAGCACCAGCTCATGTTGAAGATGGGCTCAATGATGC...
Protein
Download Protein FASTA641 aa · LXL04_015363|LXL04_015363|OH1004|PROTEIN
MAPIPLLVTATKLAGVLATITVAANAVSFSRFRKRNLAPFDSPIDETSDTLAIFNVNCSDSDDEEEEGFFFGLATAPAHVEDGLNDAWLQFAQDEVVDKQDPSPDAVMASASGDGGSQQAAGPLKRKKSLKIAMEAKLRGLVKYIEDDESSSSSEEEEEEEHNVAAWHNVPNPEERLRFWSDPDTELKLAKDTGVKVYRMGIDWTRIMPKEPVNGVKESINYAALERYRWIINRVQSYGMKVMLTLFHHSLPPWASDLGG...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_015363 |
|---|---|
| TK1151 ID | TkA02G342700 |
| OH-1004 ID | LXL04_015363 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 98.900 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_015363 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:69672733-69675924 (+) | ||||||||||||
| Description | Similar to SFR2: Beta-glucosidase-like SFR2, chloroplastic | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0005975 carbohydrate metabolic process Biological Process GO:0009409 response to cold Biological Process GO:0030245 cellulose catabolic process Biological Process GO:0050826 response to freezing Biological Process GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009507 chloroplast Cellular Component GO:0009536 plastid Cellular Component GO:0009707 chloroplast outer membrane Cellular Component GO:0009941 chloroplast envelope Cellular Component GO:0004565 beta-galactosidase activity Molecular Function GO:0008378 galactosyltransferase activity Molecular Function | ||||||||||||
| KEGG gene cross-reference | ath:AT3G06510 dosa:Os11g0683500 osa:4351127 sshi:J5U23_00486 sso:SSO3019 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00232.25Glyco_hydro_1184-368 aaPF00232.25Glyco_hydro_1390-532 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_015363 | PF00232.25 | Glyco_hydro_1 | 184 | 368 | 8.6e-54 | 183.5 |
| LXL04_015363 | PF00232.25 | Glyco_hydro_1 | 390 | 532 | 8.6e-54 | 183.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.