LXL04_015354 | RubberDandelionOmics

Gene overview

LXL04_015354

Reference: OH-1004 Chr: Chr03 Coordinates: 69343754-69347855 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2553 bp · LXL04_015354|LXL04_015354|OH1004|cDNA

ATGGGAACCACCGAGGCAGAGCATCCATGGGAACAACCCGAGCAAGACGAATTGGAGGATGATTTGATCGTTAGAAGAAAGAATCTCAACCGAACCCAACTCTCCTCCACCATCGATGGTGGTTTCAGTAGCAACGATGGTGGTTCAGTTGGTGTCACGAATGTTAAAGATCAAGaacaagatgaagaagaagaagaagaagaagtcaAAGATTTTAGTCAACAAAATGGTGTGAAGGTTAACGAAGATGAAACAGAGAA...

CDS

Download CDS FASTA

2553 bp · LXL04_015354|LXL04_015354|OH1004|CDS

ATGGGAACCACCGAGGCAGAGCATCCATGGGAACAACCCGAGCAAGACGAATTGGAGGATGATTTGATCGTTAGAAGAAAGAATCTCAACCGAACCCAACTCTCCTCCACCATCGATGGTGGTTTCAGTAGCAACGATGGTGGTTCAGTTGGTGTCACGAATGTTAAAGATCAAGAACAAGATGAAGAAGAAGAAGAAGAAGAAGTCAAAGATTTTAGTCAACAAAATGGTGTGAAGGTTAACGAAGATGAAACAGAGAA...

Protein

Download Protein FASTA

850 aa · LXL04_015354|LXL04_015354|OH1004|PROTEIN

MGTTEAEHPWEQPEQDELEDDLIVRRKNLNRTQLSSTIDGGFSSNDGGSVGVTNVKDQEQDEEEEEEEVKDFSQQNGVKVNEDETEKEKQQKSEYLVYYDADKGIWKCRICSWDYQGKTCLTDHNQSLCFFHQTKGTGLHLKSSKEEANGVDSTFHGNIPMKDNIHSQDNGNGMHFINNQNGEHEKHNKLSDSSLQPSEISFQGVKKPEISEEIEVITDVENEFDVETVLKKQETHDLFCPNCNSCITKRVILRKRKRKI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015354`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015354

Location Chr03:69343754-69347855 (+)

Description Similar to MEB1: Membrane protein of ER body 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g27860`	May sequester excess cytosolic iron and manganese into endoplasmic reticulum to reduce metal ion toxicity.	Identification of two novel endoplasmic reticulum body-specific integral membrane proteins.2013 · DOI: 10.1104/pp.112.207654
`At4g27870`	Not essential for the accumulation of ER body components, including PYK10.	No verified direct reference in this release
`At5g24290`	May sequester excess cytosolic iron and manganese into endoplasmic reticulum to reduce metal ion toxicity.	Identification of two novel endoplasmic reticulum body-specific integral membrane proteins.2013 · DOI: 10.1104/pp.112.207654

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015354 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009753 response to jasmonic acid Biological Process

GO:0010039 response to iron ion Biological Process

GO:0030026 intracellular manganese ion homeostasis Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

GO:0010168 ER body Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT4G27860

ath:AT4G27870

ath:AT5G24290

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.651

Rank 1 · LXL04_015354 · OH-1004

Endoplasmic reticulum0.191

Rank 2 · LXL04_015354 · OH-1004

Cytoplasm0.120

Rank 3 · LXL04_015354 · OH-1004

Nucleus0.104

Rank 4 · LXL04_015354 · OH-1004

Lysosome / Vacuole0.073

Rank 5 · LXL04_015354 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W4P8`	Arabidopsis thaliana	Membrane protein of ER body 1	42.786%	Swiss-Prot	weak database homology
`Q8LPT3`	Arabidopsis thaliana	Membrane protein of ER body-like protein	49.215%	Swiss-Prot	weak database homology
`F4KFS7`	Arabidopsis thaliana	Membrane protein of ER body 2	41.622%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card