LXL04_015292 | RubberDandelionOmics

Gene overview

LXL04_015292

Reference: OH-1004 Chr: Chr03 Coordinates: 67627853-67629105 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

909 bp · LXL04_015292|LXL04_015292|OH1004|cDNA

ATGGAAGAGCAAATCGATTGGGACAATCTCTTTGACTTTGATGACAGTCTATGCGATTCCTCCCCCATCCTTCCAACTTCATCACCGAATCAGGGAAACAGCCACTCTCCCTTGTCTGTTGATGATATCGAGCAGTTACTTTTGAATGATGACGACGAAATTCATAACGCTGATGCGTTAAACTCGGTTCAGGAGGCGGTCGATGTGTTTTTTCATGATATTTTGCTTGATTCGCCTTTAGACGTGGAAAAATCCGGTGA...

CDS

Download CDS FASTA

909 bp · LXL04_015292|LXL04_015292|OH1004|CDS

ATGGAAGAGCAAATCGATTGGGACAATCTCTTTGACTTTGATGACAGTCTATGCGATTCCTCCCCCATCCTTCCAACTTCATCACCGAATCAGGGAAACAGCCACTCTCCCTTGTCTGTTGATGATATCGAGCAGTTACTTTTGAATGATGACGACGAAATTCATAACGCTGATGCGTTAAACTCGGTTCAGGAGGCGGTCGATGTGTTTTTTCATGATATTTTGCTTGATTCGCCTTTAGACGTGGAAAAATCCGGTGA...

Protein

Download Protein FASTA

302 aa · LXL04_015292|LXL04_015292|OH1004|PROTEIN

MEEQIDWDNLFDFDDSLCDSSPILPTSSPNQGNSHSPLSVDDIEQLLLNDDDEIHNADALNSVQEAVDVFFHDILLDSPLDVEKSGEVVDISDGDNSVEEQKNEVVVDHKDEKENSDDFKEEKENSDDDPSDPLDKKRKRQLRNKDAALRSRERKKMYVKDLEMKSRYYEAECKRLGSLLQCFMAENQALRFSLHSSKAYNVSTTKQESAVLFLESLLLGSLLWLVAIVCQLVLPSLHLQNPGADQLETMVGRNLLSLVV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015292`
TK1151 ID	TkA02G348360
OH-1004 ID	LXL04_015292
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	87.400
Protein coverage (%)	TK1151 94.425 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015292

Location Chr03:67627853-67629105 (-)

Description Similar to BZIP50: bZIP transcription factor 50

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g42990`	Transcription factor involved in the unfolded protein response (UPR).	An Arabidopsis transcription factor, AtbZIP60, regulates the endoplasmic reticulum stress response in a manner unique to plants.2005 · DOI: 10.1073/pnas.0408941102 Endoplasmic reticulum stress activates the expression of a sub-group of protein disulfide isomerase genes and AtbZIP60 modulates the response in Arabidopsis thaliana.2008 · DOI: 10.1007/s00438-008-0356-z Arabidopsis bZIP60 is a proteolysis-activated transcription factor involved in the endoplasmic reticulum stress response.2008 · DOI: 10.1105/tpc.108.061002 Heat induces the splicing by IRE1 of a mRNA encoding a transcription factor involved in the unfolded protein response in Arabidopsis.2011 · DOI: 10.1073/pnas.1102117108 IRE1/bZIP60-mediated unfolded protein response plays distinct roles in plant immunity and abiotic stress responses.2012 · DOI: 10.1371/journal.pone.0031944
`At2g40950`	Transcriptional activator involved in salt and osmotic stress responses.	Salt stress responses in Arabidopsis utilize a signal transduction pathway related to endoplasmic reticulum stress signaling.2007 · DOI: 10.1111/j.1365-313x.2007.03195.x Signaling from the endoplasmic reticulum activates brassinosteroid signaling and promotes acclimation to stress in Arabidopsis.2010 · DOI: 10.1126/scisignal.2001140

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0622700`	Transcription factor involved in endoplasmic reticulum (ER) stress response.	Expression of ER quality control-related genes in response to changes in BiP1 levels in developing rice endosperm.2011 · DOI: 10.1111/j.1365-313x.2010.04453.x Signal transduction by IRE1-mediated splicing of bZIP50 and other stress sensors in the endoplasmic reticulum stress response of rice.2012 · DOI: 10.1111/j.1365-313x.2011.04844.x Conservation of IRE1-regulated bZIP74 mRNA unconventional splicing in rice (Oryza sativa L.) involved in ER stress responses.2012 · DOI: 10.1093/mp/ssr115
`Os07g0644100`	Transcription factor involved in endoplasmic reticulum (ER) stress response.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015292 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002376 immune system process Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006986 response to unfolded protein Biological Process

GO:0030968 endoplasmic reticulum unfolded protein response Biological Process

GO:0034976 response to endoplasmic reticulum stress Biological Process

GO:0042538 hyperosmotic salinity response Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

KEGG gene cross-reference

ath:AT1G42990

ath:AT2G40950

dosa:Os06g0622700

dosa:Os07g0644100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.916

Rank 1 · LXL04_015292 · OH-1004

Cytoplasm0.164

Rank 2 · LXL04_015292 · OH-1004

Cell membrane0.033

Rank 3 · LXL04_015292 · OH-1004

Endoplasmic reticulum0.029

Rank 4 · LXL04_015292 · OH-1004

Mitochondrion0.015

Rank 5 · LXL04_015292 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00170.27bZIP_1135-191 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015292	`PF00170.27`	bZIP_1	135	191	2.6e-07	31.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C7S0`	Arabidopsis thaliana	bZIP transcription factor 60	40.761%	Swiss-Prot	moderate database homology
`O22208`	Arabidopsis thaliana	bZIP transcription factor 17	32.667%	Swiss-Prot	weak database homology
`Q69XV0`	Oryza sativa subsp. japonica	bZIP transcription factor 50	44.712%	Swiss-Prot	moderate database homology
`Q8LIB3`	Oryza sativa subsp. japonica	bZIP transcription factor 60	42.373%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card