LXL04_015267 | RubberDandelionOmics

Gene overview

LXL04_015267

Reference: OH-1004 Chr: Chr03 Coordinates: 67267812-67270690 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

663 bp · LXL04_015267|LXL04_015267|OH1004|cDNA

ATGGCTTCTTTGCAGAAAATAACTTTTGAAAGTCCTCTGATTTCCGCGAAACCCATAGAAGAACCTCAACAATTCCATCAAAATCAAACATTTTTGCCATTACCCATTTCAAGAAGATCAGCAATTTTGATATCTGTTCTTCCATTTGCCCTAACTTCTAACCCTCAAGAAGCTGTGGCAAGAGAAAGACGCAATAGAAAAGTTATCCCTCTCGAAGACTACCTCACTAGCGCTGACGGGCTGAAATACTATGATATCAT...

CDS

Download CDS FASTA

663 bp · LXL04_015267|LXL04_015267|OH1004|CDS

ATGGCTTCTTTGCAGAAAATAACTTTTGAAAGTCCTCTGATTTCCGCGAAACCCATAGAAGAACCTCAACAATTCCATCAAAATCAAACATTTTTGCCATTACCCATTTCAAGAAGATCAGCAATTTTGATATCTGTTCTTCCATTTGCCCTAACTTCTAACCCTCAAGAAGCTGTGGCAAGAGAAAGACGCAATAGAAAAGTTATCCCTCTCGAAGACTACCTCACTAGCGCTGACGGGCTGAAATACTATGATATCAT...

Protein

Download Protein FASTA

220 aa · LXL04_015267|LXL04_015267|OH1004|PROTEIN

MASLQKITFESPLISAKPIEEPQQFHQNQTFLPLPISRRSAILISVLPFALTSNPQEAVARERRNRKVIPLEDYLTSADGLKYYDIIEGKGPTAEKGSIVQVHFDCVYNKITAVSSRESKILAGNRTIAQPYEFKVGAPPGRERKRDFVDNPNGLFSAQAAPKPPPAMYSVVEGMKVGGKRRVIVPPEAGFGKKGMNEIPPGATFELNLELLQVTRPEGK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015267`
TK1151 ID	TkA02G349440
OH-1004 ID	LXL04_015267
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015267

Location Chr03:67267812-67270690 (+)

Description Similar to FKBP18: Peptidyl-prolyl cis-trans isomerase FKBP18, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g20810`	PPIases accelerate the folding of proteins.	No verified direct reference in this release
`At3g10060`	PPIases accelerate the folding of proteins.	No verified direct reference in this release
`At5g05420`	PPIases accelerate the folding of proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015267 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005788 endoplasmic reticulum lumen Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009543 chloroplast thylakoid lumen Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0031977 thylakoid lumen Cellular Component

GO:0003755 peptidyl-prolyl cis-trans isomerase activity Molecular Function

GO:0005509 calcium ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G20810

ath:AT3G10060

ath:AT5G05420

hsa:55033

pon:100174527

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.979

Rank 1 · LXL04_015267 · OH-1004

Mitochondrion0.026

Rank 2 · LXL04_015267 · OH-1004

Nucleus0.013

Rank 3 · LXL04_015267 · OH-1004

Cytoplasm0.011

Rank 4 · LXL04_015267 · OH-1004

Cell membrane0.009

Rank 5 · LXL04_015267 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00254.35FKBP_C93-212 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015267	`PF00254.35`	FKBP_C	93	212	3e-13	50.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LM71`	Arabidopsis thaliana	Peptidyl-prolyl cis-trans isomerase FKBP18, chloroplastic	66.364%	Swiss-Prot	strong database homology
`Q9SR70`	Arabidopsis thaliana	Peptidyl-prolyl cis-trans isomerase FKBP16-4, chloroplastic	38.503%	Swiss-Prot	moderate database homology
`Q9FLB3`	Arabidopsis thaliana	Peptidyl-prolyl cis-trans isomerase FKBP15-3	46.512%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card