LXL04_015260 | RubberDandelionOmics

Gene overview

LXL04_015260

Reference: OH-1004 Chr: Chr03 Coordinates: 67057150-67059620 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1148 bp · LXL04_015260|LXL04_015260|OH1004|cDNA

ATGTTCAAAAAGGCACGTGATGAAAATGCCCAACAAGCAGAAGCAGAAAAGAAGAGATTAGAAAAAGAAGCTCATAAAGAGCAACAATCTTTAAGGAAAGAAAGCATGATTGATGTTGACCACAAGAAAGACCTCAAAATCATGATCCCGAAAATTGGAGCTGTGGTTGAACCGGTCTACATTAACCCGGTGTTGCCTCCGGGTCACGGTCCGACCGGTTGGACCGGCCGGCTTTCCACGATTTCGACCACTCTGCCCTC...

CDS

Download CDS FASTA

1119 bp · LXL04_015260|LXL04_015260|OH1004|CDS

ATGTTCAAAAAGGCACGTGATGAAAATGCCCAACAAGCAGAAGCAGAAAAGAAGAGATTAGAAAAAGAAGCTCATAAAGAGCAACAATCTTTAAGGAAAGAAAGCATGATTGATGTTGACCACAAGAAAGACCTCAAAATCATGATCCCGAAAATTGGAGCTGTGGTTGAACCGGTCTACATTAACCCGGTGTTGCCTCCGGGTCACGGTCCGACCGGTTGGACCGGCCGGCTTTCCACGATTTCGACCACTCTGCCCTC...

Protein

Download Protein FASTA

372 aa · LXL04_015260|LXL04_015260|OH1004|PROTEIN

MFKKARDENAQQAEAEKKRLEKEAHKEQQSLRKESMIDVDHKKDLKIMIPKIGAVVEPVYINPVLPPGHGPTGWTGRLSTISTTLPSSRLLPSPAPSRRRCPQSALGCSFSASLLQVSDLTPIPSNKVRFISNSSLIMSSILQKRKTPDPKPKAGASLPESERLVLNIIKSRKENAIVVTDLKKEAKLPQPIFNKCLKNLQASGLVKEVPHVQFKGRKHYISADFEPSEEVTGGAWYADGELDTDFIEVLKNTSIKIIRK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015260`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_015260`
Location	Chr03:67057150-67059620 (-)
Description	Similar to Polr3f: DNA-directed RNA polymerase III subunit RPC6
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_015260` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006359 regulation of transcription by RNA polymerase III Biological Process GO:0006383 transcription by RNA polymerase III Biological Process GO:0006384 transcription initiation at RNA polymerase III promoter Biological Process GO:0006386 termination of RNA polymerase III transcription Biological Process GO:0032728 positive regulation of interferon-beta production Biological Process GO:0045087 innate immune response Biological Process GO:0045089 positive regulation of innate immune response Biological Process GO:0051607 defense response to virus Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005666 RNA polymerase III complex Cellular Component GO:0005737 cytoplasm Cellular Component
KEGG gene cross-reference	bta:529410 ddi:DDB_G0272022 dme:Dmel_CG5380 hsa:10621 mmu:70408 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.677

Rank 1 · LXL04_015260 · OH-1004

Cytoplasm0.333

Rank 2 · LXL04_015260 · OH-1004

Mitochondrion0.051

Rank 3 · LXL04_015260 · OH-1004

Cell membrane0.035

Rank 4 · LXL04_015260 · OH-1004

Endoplasmic reticulum0.030

Rank 5 · LXL04_015260 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05158.19RNA_pol_Rpc34156-266 aa

PF05158.19RNA_pol_Rpc34264-371 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015260	`PF05158.19`	RNA_pol_Rpc34	156	266	5e-42	145.2
LXL04_015260	`PF05158.19`	RNA_pol_Rpc34	264	371	5e-42	145.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card