LXL04_015246 | RubberDandelionOmics

Gene overview

LXL04_015246

Reference: OH-1004 Chr: Chr03 Coordinates: 66766260-66774083 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5361 bp · LXL04_015246|LXL04_015246|OH1004|cDNA

ATGGAGGTTGTATCTGCTATCATTGGTCCTATTGTTGAATCTTTATTGGTTCCAGTGAAGAAACAGCTGGGATATCTATTTTCCTCAACAAAACATGTTGGTAAGATGAATGCTAGAATGAAGCAATTGCACGATACAAGCATTGATGTCACAAAACACATGGAAGCAAACAAAATAAGCAATCAGGAGATACCTACTCATGTGCCTGGTTGGCTGAAAGAGGTCGCAAAGATTGAGGAAGATGCCAAAAGAATTTCAAG...

CDS

Download CDS FASTA

5361 bp · LXL04_015246|LXL04_015246|OH1004|CDS

ATGGAGGTTGTATCTGCTATCATTGGTCCTATTGTTGAATCTTTATTGGTTCCAGTGAAGAAACAGCTGGGATATCTATTTTCCTCAACAAAACATGTTGGTAAGATGAATGCTAGAATGAAGCAATTGCACGATACAAGCATTGATGTCACAAAACACATGGAAGCAAACAAAATAAGCAATCAGGAGATACCTACTCATGTGCCTGGTTGGCTGAAAGAGGTCGCAAAGATTGAGGAAGATGCCAAAAGAATTTCAAG...

Protein

Download Protein FASTA

1786 aa · LXL04_015246|LXL04_015246|OH1004|PROTEIN

MEVVSAIIGPIVESLLVPVKKQLGYLFSSTKHVGKMNARMKQLHDTSIDVTKHMEANKISNQEIPTHVPGWLKEVAKIEEDAKRISSIENGCFNLKMRYSRGRTACKTSEVIEKLIKENSEMSWRDVQRPLGKVKSHITSTSAVSNDDGDAQNHFKSREHTFKDALESLQQDQIIKAIALCGMGGVGKTTMMEQLKKTAEDKKMFDYIVKVVIGQQINIPKIQQDVAEYIIGKSLSELSQEVRADRLRIAFEKLSEDKKK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015246`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015246

Location Chr03:66766260-66774083 (+)

Description Similar to At4g27190: Disease resistance protein At4g27190

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g27190`	Disease resistance protein.	No verified direct reference in this release
`At4g27220`	Probable disease resistance protein.	No verified direct reference in this release
`At5g47250`	Probable disease resistance protein.	No verified direct reference in this release
`At5g43740`	Probable disease resistance protein.	No verified direct reference in this release
`At1g12210`	Disease resistance (R) protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015246 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009617 response to bacterium Biological Process

GO:0098542 defense response to other organism Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0043531 ADP binding Molecular Function

KEGG gene cross-reference

ath:AT1G12210

ath:AT4G27190

ath:AT4G27220

ath:AT5G43740

ath:AT5G47250

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.503

Rank 1 · LXL04_015246 · OH-1004

Cytoplasm0.318

Rank 2 · LXL04_015246 · OH-1004

Nucleus0.238

Rank 3 · LXL04_015246 · OH-1004

Endoplasmic reticulum0.084

Rank 4 · LXL04_015246 · OH-1004

Extracellular0.043

Rank 5 · LXL04_015246 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00931.29NB-ARC160-334 aa

PF23598.2LRR_14581-693 aa

PF23247.2LRR_RPS2680-816 aa

PF23247.2LRR_RPS2756-882 aa

PF23247.2LRR_RPS2932-1079 aa

PF23247.2LRR_RPS21124-1239 aa

PF23247.2LRR_RPS21194-1278 aa

PF23247.2LRR_RPS21319-1370 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015246	`PF00931.29`	NB-ARC	160	334	1.5e-23	83.9
LXL04_015246	`PF23598.2`	LRR_14	581	693	1.4e-09	37.9
LXL04_015246	`PF23247.2`	LRR_RPS2	680	816	1.4e-94	315.1
LXL04_015246	`PF23247.2`	LRR_RPS2	756	882	1.4e-94	315.1
LXL04_015246	`PF23247.2`	LRR_RPS2	932	1079	1.4e-94	315.1
LXL04_015246	`PF23247.2`	LRR_RPS2	1124	1239	1.4e-94	315.1
LXL04_015246	`PF23247.2`	LRR_RPS2	1194	1278	1.4e-94	315.1
LXL04_015246	`PF23247.2`	LRR_RPS2	1319	1370	1.4e-94	315.1
LXL04_015246	`PF23247.2`	LRR_RPS2	1398	1499	1.4e-94	315.1
LXL04_015246	`PF23247.2`	LRR_RPS2	1552	1685	1.4e-94	315.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9T048`	Arabidopsis thaliana	Disease resistance protein At4g27190	23.720%	Swiss-Prot	weak database homology
`O81825`	Arabidopsis thaliana	Probable disease resistance protein At4g27220	25.933%	Swiss-Prot	weak database homology
`Q9LVT4`	Arabidopsis thaliana	Probable disease resistance protein At5g47250	23.188%	Swiss-Prot	weak database homology
`Q9FG90`	Arabidopsis thaliana	Probable disease resistance protein At5g43740	24.926%	Swiss-Prot	weak database homology
`Q8L3R3`	Arabidopsis thaliana	Disease resistance protein RFL1	25.211%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card