LXL04_015236 | RubberDandelionOmics

Gene overview

LXL04_015236

Reference: OH-1004 Chr: Chr03 Coordinates: 66548365-66551178 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2814 bp · LXL04_015236|LXL04_015236|OH1004|cDNA

ATGGCTGTAGAGGCAGTAGTGTCTGTGGTGTTGCAGAAACTAAGCGACATGCTGAAAGGGGAATCATTAACTCAAAACAAAGTTATAGTGTACGAAGTCCAGGGGATGATGAAGTCGCTCAACTCAATGAGAGGCTTGATCTCCTCCAAGGATATCAATCAGAGAGCAGATGGGTATCTGGATGCTATTTACAACATGGAGGACAAGATCGAGAAGTTCACTCTCATTGTTTCTTGCAGGCGGAAGGTATTTGGTCTGTT...

CDS

Download CDS FASTA

2814 bp · LXL04_015236|LXL04_015236|OH1004|CDS

ATGGCTGTAGAGGCAGTAGTGTCTGTGGTGTTGCAGAAACTAAGCGACATGCTGAAAGGGGAATCATTAACTCAAAACAAAGTTATAGTGTACGAAGTCCAGGGGATGATGAAGTCGCTCAACTCAATGAGAGGCTTGATCTCCTCCAAGGATATCAATCAGAGAGCAGATGGGTATCTGGATGCTATTTACAACATGGAGGACAAGATCGAGAAGTTCACTCTCATTGTTTCTTGCAGGCGGAAGGTATTTGGTCTGTT...

Protein

Download Protein FASTA

937 aa · LXL04_015236|LXL04_015236|OH1004|PROTEIN

MAVEAVVSVVLQKLSDMLKGESLTQNKVIVYEVQGMMKSLNSMRGLISSKDINQRADGYLDAIYNMEDKIEKFTLIVSCRRKVFGLLGNHIFIFNNINSCHKIHHKIKKITVKLMKQRDKTDVGGTKLELLMKQGSFSISETQATTPGGLEELSFNYSCNEEEIQIVGIKQRFQQTRRLSSFSYIEEELGIFGRNEDVDTLMNKLTDINSGHVVSILGQSGIGKTTLARTIYKSKEIKRHFQFRAWVSVLDKYTAKDILQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015236`
TK1151 ID	TkA02G353200
OH-1004 ID	LXL04_015236
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	97.500
Protein coverage (%)	TK1151 99.339 / OH-1004 64.141 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015236

Location Chr03:66548365-66551178 (-)

Description Similar to RPP8L3: Disease resistance RPP8-like protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g35450`	Disease resistance protein.	No verified direct reference in this release
`At1g53350`	Potential disease resistance protein.	No verified direct reference in this release
`At1g58390`	Possible disease resistance protein.	No verified direct reference in this release
`At3g07040`	Disease resistance (R) protein that specifically recognizes the AvrRpm1 type III effector avirulence protein from Pseudomonas syringae.	The Arabidopsis thaliana RPM1 disease resistance gene product is a peripheral plasma membrane protein that is degraded coincident with the hypersensitive response.1998 · DOI: 10.1073/pnas.95.26.15849
`At1g59780`	Potential disease resistance protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015236 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0098542 defense response to other organism Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0012505 endomembrane system Cellular Component

GO:0031234 extrinsic component of cytoplasmic side of plasma membrane Cellular Component

GO:0000166 nucleotide binding Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0043531 ADP binding Molecular Function

KEGG gene cross-reference

ath:AT1G53350

ath:AT1G58390

ath:AT1G59780

ath:AT3G07040

ath:AT5G35450

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.604

Rank 1 · LXL04_015236 · OH-1004

Cytoplasm0.222

Rank 2 · LXL04_015236 · OH-1004

Nucleus0.186

Rank 3 · LXL04_015236 · OH-1004

Endoplasmic reticulum0.060

Rank 4 · LXL04_015236 · OH-1004

Plastid0.041

Rank 5 · LXL04_015236 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13191.13AAA_16192-241 aa

PF00931.29NB-ARC195-361 aa

PF23559.2WHD_DRP434-504 aa

PF23598.2LRR_14607-880 aa

PF13855.13LRR_8632-686 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015236	`PF13191.13`	AAA_16	192	241	3.8e-06	28.2
LXL04_015236	`PF00931.29`	NB-ARC	195	361	2.8e-31	109.1
LXL04_015236	`PF23559.2`	WHD_DRP	434	504	1.1e-16	61.3
LXL04_015236	`PF23598.2`	LRR_14	607	880	3.4e-42	145.2
LXL04_015236	`PF13855.13`	LRR_8	632	686	2.8e-07	30.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FJB5`	Arabidopsis thaliana	Disease resistance RPP8-like protein 3	27.463%	Swiss-Prot	weak database homology
`P0C8S1`	Arabidopsis thaliana	Probable disease resistance RPP8-like protein 2	27.038%	Swiss-Prot	weak database homology
`Q8W474`	Arabidopsis thaliana	Probable disease resistance protein At1g58390	29.036%	Swiss-Prot	weak database homology
`Q39214`	Arabidopsis thaliana	Disease resistance protein RPM1	29.019%	Swiss-Prot	weak database homology
`Q9XIF0`	Arabidopsis thaliana	Putative disease resistance protein At1g59780	27.765%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card