LXL04_015200 | RubberDandelionOmics

Gene overview

LXL04_015200

Reference: OH-1004 Chr: Chr03 Coordinates: 65774171-65786729 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5304 bp · LXL04_015200|LXL04_015200|OH1004|cDNA

ATGGAAGTAGTCAATGAACTTTTGAAACAAGTTGTTCCGATCCTGATGAATCCTATTAGCAGATATCTACGGTACATGGTTTCCTGCCCAAAGTACATGAGGTACATGGTTATTAAAATGAAGGAGTTAGATTCTACAATAGTTGGTGTCGAAGAACACATTATTAGGAACACTCATATGAATCTTGAGGTTCCAGCCCAAGTTAACAGTTGGCTGGAAGATGTAAGAAAAATTAAAGCGAAAGCAGAAAATGTTCCTAC...

CDS

Download CDS FASTA

5304 bp · LXL04_015200|LXL04_015200|OH1004|CDS

ATGGAAGTAGTCAATGAACTTTTGAAACAAGTTGTTCCGATCCTGATGAATCCTATTAGCAGATATCTACGGTACATGGTTTCCTGCCCAAAGTACATGAGGTACATGGTTATTAAAATGAAGGAGTTAGATTCTACAATAGTTGGTGTCGAAGAACACATTATTAGGAACACTCATATGAATCTTGAGGTTCCAGCCCAAGTTAACAGTTGGCTGGAAGATGTAAGAAAAATTAAAGCGAAAGCAGAAAATGTTCCTAC...

Protein

Download Protein FASTA

1767 aa · LXL04_015200|LXL04_015200|OH1004|PROTEIN

MEVVNELLKQVVPILMNPISRYLRYMVSCPKYMRYMVIKMKELDSTIVGVEEHIIRNTHMNLEVPAQVNSWLEDVRKIKAKAENVPTEYVSCFNMKIRHMTGRNAFYIIEEIESLMKRHSLIAWNDHPIPLGRVDSNQASTSTLLVEHNDFPSREVTFMEALKALGPNHTSHMVALWGMGGVGKTTMMMKLKETVSQKKMFKYIIPLDIGEKAELINIQKTVASYLGIDLNDKNKSVRAEILRQGFKAKSDGGKTKFFIV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015200`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015200

Location Chr03:65774171-65786729 (+)

Description Similar to RPS2: Disease resistance protein RPS2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g26090`	Disease resistance (R) protein that specifically recognizes the AvrRpt2 type III effector avirulence protein from Pseudomonas syringae.	No verified direct reference in this release
`At4g27220`	Probable disease resistance protein.	No verified direct reference in this release
`At4g27190`	Disease resistance protein.	No verified direct reference in this release
`At1g61190`	Probable disease resistance protein.	No verified direct reference in this release
`At1g61180`	Involved in disease resistance via the salicylic acid (SA) signaling pathway.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015200 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002220 innate immune response activating cell surface receptor signaling pathway Biological Process

GO:0006952 defense response Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0016045 detection of bacterium Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0098542 defense response to other organism Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0043531 ADP binding Molecular Function

KEGG gene cross-reference

ath:AT1G61180

ath:AT1G61190

ath:AT4G26090

ath:AT4G27190

ath:AT4G27220

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.587

Rank 1 · LXL04_015200 · OH-1004

Cytoplasm0.258

Rank 2 · LXL04_015200 · OH-1004

Nucleus0.218

Rank 3 · LXL04_015200 · OH-1004

Endoplasmic reticulum0.086

Rank 4 · LXL04_015200 · OH-1004

Extracellular0.043

Rank 5 · LXL04_015200 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00931.29NB-ARC163-325 aa

PF23598.2LRR_14566-648 aa

PF23247.2LRR_RPS2763-855 aa

PF23247.2LRR_RPS2861-1011 aa

PF23247.2LRR_RPS21062-1148 aa

PF23247.2LRR_RPS21151-1244 aa

PF23247.2LRR_RPS21289-1341 aa

PF23247.2LRR_RPS21360-1479 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015200	`PF00931.29`	NB-ARC	163	325	9.7e-23	81.3
LXL04_015200	`PF23598.2`	LRR_14	566	648	3.5e-10	39.9
LXL04_015200	`PF23247.2`	LRR_RPS2	763	855	3.1e-105	349.8
LXL04_015200	`PF23247.2`	LRR_RPS2	861	1011	3.1e-105	349.8
LXL04_015200	`PF23247.2`	LRR_RPS2	1062	1148	3.1e-105	349.8
LXL04_015200	`PF23247.2`	LRR_RPS2	1151	1244	3.1e-105	349.8
LXL04_015200	`PF23247.2`	LRR_RPS2	1289	1341	3.1e-105	349.8
LXL04_015200	`PF23247.2`	LRR_RPS2	1360	1479	3.1e-105	349.8
LXL04_015200	`PF23247.2`	LRR_RPS2	1526	1655	3.1e-105	349.8
LXL04_015200	`PF23247.2`	LRR_RPS2	1642	1724	3.1e-105	349.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q42484`	Arabidopsis thaliana	Disease resistance protein RPS2	26.631%	Swiss-Prot	weak database homology
`O81825`	Arabidopsis thaliana	Probable disease resistance protein At4g27220	26.285%	Swiss-Prot	weak database homology
`Q9T048`	Arabidopsis thaliana	Disease resistance protein At4g27190	24.973%	Swiss-Prot	weak database homology
`O22727`	Arabidopsis thaliana	Probable disease resistance protein At1g61190	25.788%	Swiss-Prot	weak database homology
`Q940K0`	Arabidopsis thaliana	Disease resistance protein UNI	23.987%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card