LXL04_015183 | RubberDandelionOmics

Gene overview

LXL04_015183

Reference: OH-1004 Chr: Chr03 Coordinates: 65392551-65396032 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1305 bp · LXL04_015183|LXL04_015183|OH1004|cDNA

ATGGCACTGAATTCGGGTGCGCCGCATCCGCCGTTTGCGTTGCGGTTGCGGGAAGTGGATTCTCGTCCGACGGTGTCACTGGAGCAGAAGCTGTTGATTCTTCGAGGTGATTGTAGGTTTAAATGCTGCTGTTCGGATAAGGTTGTGCCGATTCGCAGAGTTGTTACCTGTGCCGGGCGTAAGGGCGTGGATAAAATTGAAGAATGGCCGAGTGATCTGAGGAAGAAGGTTCATAAAGTTCGAGCGCAAGCTTCACCTGC...

CDS

Download CDS FASTA

1305 bp · LXL04_015183|LXL04_015183|OH1004|CDS

ATGGCACTGAATTCGGGTGCGCCGCATCCGCCGTTTGCGTTGCGGTTGCGGGAAGTGGATTCTCGTCCGACGGTGTCACTGGAGCAGAAGCTGTTGATTCTTCGAGGTGATTGTAGGTTTAAATGCTGCTGTTCGGATAAGGTTGTGCCGATTCGCAGAGTTGTTACCTGTGCCGGGCGTAAGGGCGTGGATAAAATTGAAGAATGGCCGAGTGATCTGAGGAAGAAGGTTCATAAAGTTCGAGCGCAAGCTTCACCTGC...

Protein

Download Protein FASTA

434 aa · LXL04_015183|LXL04_015183|OH1004|PROTEIN

MALNSGAPHPPFALRLREVDSRPTVSLEQKLLILRGDCRFKCCCSDKVVPIRRVVTCAGRKGVDKIEEWPSDLRKKVHKVRAQASPAWSFASSQPQLASRHEKFFPRCTPRNSGPQSRDTPPKRDTGIANEKEMGINLLSEDVNESGINEDGSTWYRESGVDLGENGYRCRWTRMGGQSSDASSKWKEAVLRNLVKILKGIPGGKPGVKFFTKMNGARIERSAQKQAKSGTENAGWYENWYALSPFIMRAFTSFTHKWEK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015183`
TK1151 ID	TkA02G358350
OH-1004 ID	LXL04_015183
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	81.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015183

Location Chr03:65392551-65396032 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g42430`	Binds preferentially to highly ordered alpha-glucans, such as starch and crystalline maltodextrins.	The Starch Granule-Associated Protein EARLY STARVATION1 Is Required for the Control of Starch Degradation in Arabidopsis thaliana Leaves.2016 · DOI: 10.1105/tpc.16.00011 EARLY STARVATION 1 Is a Functionally Conserved Protein Promoting Gravitropic Responses in Plants by Forming Starch Granules.2021 · DOI: 10.3389/fpls.2021.628948 LIKE EARLY STARVATION 1 alters the glucan structures at the starch granule surface and thereby influences the action of both starch-synthesizing and starch-degrading enzymes.2022 · DOI: 10.1111/tpj.15855
`At3g55760`	Binds preferentially to highly ordered alpha-glucans, such as starch and crystalline maltodextrins.	The Starch Granule-Associated Protein EARLY STARVATION1 Is Required for the Control of Starch Degradation in Arabidopsis thaliana Leaves.2016 · DOI: 10.1105/tpc.16.00011 LIKE EARLY STARVATION 1 alters the glucan structures at the starch granule surface and thereby influences the action of both starch-synthesizing and starch-degrading enzymes.2022 · DOI: 10.1111/tpj.15855

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2XC52`	Binds preferentially to highly ordered alpha-glucans, such as starch and crystalline maltodextrins (By similarity).	No verified direct reference in this release
`Os03g0133300`	Binds preferentially to highly ordered alpha-glucans, such as starch and crystalline maltodextrins (By similarity).	EARLY STARVATION 1 Is a Functionally Conserved Protein Promoting Gravitropic Responses in Plants by Forming Starch Granules.2021 · DOI: 10.3389/fpls.2021.628948

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015183 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005982 starch metabolic process Biological Process

GO:0009958 positive gravitropism Biological Process

GO:0009959 negative gravitropism Biological Process

GO:0032948 regulation of alpha-glucan metabolic process Biological Process

GO:0048316 seed development Biological Process

GO:2000904 regulation of starch metabolic process Biological Process

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0043036 starch grain Cellular Component

GO:2001070 starch binding Molecular Function

KEGG gene cross-reference

ath:AT1G42430

ath:AT3G55760

dosa:Os03g0133300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.920

Rank 1 · LXL04_015183 · OH-1004

Mitochondrion0.107

Rank 2 · LXL04_015183 · OH-1004

Cytoplasm0.056

Rank 3 · LXL04_015183 · OH-1004

Nucleus0.036

Rank 4 · LXL04_015183 · OH-1004

Peroxisome0.024

Rank 5 · LXL04_015183 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28232.1LESV147-241 aa

PF28232.1LESV257-384 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015183	`PF28232.1`	LESV	147	241	2.4e-60	204.6
LXL04_015183	`PF28232.1`	LESV	257	384	2.4e-60	204.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4I9G2`	Arabidopsis thaliana	Protein EARLY STARVATION 1, chloroplastic	63.706%	Swiss-Prot	strong database homology
`Q5EAH9`	Arabidopsis thaliana	Protein LIKE EARLY STARVATION, chloroplastic	36.455%	Swiss-Prot	moderate database homology
`A2XC52`	Oryza sativa subsp. indica	Protein EARLY STARVATION 1, chloroplastic	63.021%	Swiss-Prot	strong database homology
`Q8H8C6`	Oryza sativa subsp. japonica	Protein EARLY STARVATION 1, chloroplastic	63.021%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card