LXL04_015155 | RubberDandelionOmics

Gene overview

LXL04_015155

Reference: OH-1004 Chr: Chr03 Coordinates: 65066709-65072073 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3987 bp · LXL04_015155|LXL04_015155|OH1004|cDNA

ATGGAAATTGTTGGTGATTTCTCCAATATGTGTTCTGATTTGGCTATTTCCATCTATGATGAGCTAGATTCGTCTTTTATCACCCTTGTTGTTTACAAAAATAAGCTCAATTTGGGAATATCTAAACCTAGATCtgtaggggtgagcaaaaccgaactaggaaaccgaaaaaccgaagAAAACCGATCAAACcgaaaccgagaaaccgaaaCCGAAGGGAAACCATTAGCgcgggttttgattttttttaaaaccgaata...

CDS

Download CDS FASTA

3987 bp · LXL04_015155|LXL04_015155|OH1004|CDS

ATGGAAATTGTTGGTGATTTCTCCAATATGTGTTCTGATTTGGCTATTTCCATCTATGATGAGCTAGATTCGTCTTTTATCACCCTTGTTGTTTACAAAAATAAGCTCAATTTGGGAATATCTAAACCTAGATCTGTAGGGGTGAGCAAAACCGAACTAGGAAACCGAAAAACCGAAGAAAACCGATCAAACCGAAACCGAGAAACCGAAACCGAAGGGAAACCATTAGCGCGGGTTTTGATTTTTTTTAAAACCGAATA...

Protein

Download Protein FASTA

1328 aa · LXL04_015155|LXL04_015155|OH1004|PROTEIN

MEIVGDFSNMCSDLAISIYDELDSSFITLVVYKNKLNLGISKPRSVGVSKTELGNRKTEENRSNRNRETETEGKPLARVLIFFKTEYSSPPSPLLLLHLHRGSNGDTECTPTAANRRRLAEEGRSTRSSVEFANAIELIETKQTRFISIHTSVLYCILRSGDGYSNEGAEFEKTRISFAGIEGRKCQTVDEFDSKLKENGAEMPDYFVHTLMKIIHAILPLKVKSKSDKDASKKDDNGPKSSFSALNIGDTKDRVKELER...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015155`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015155

Location Chr03:65066709-65072073 (+)

Description Similar to At3g26560: Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g26560`	May be involved in pre-mRNA splicing.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015155 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000398 mRNA splicing, via spliceosome Biological Process

GO:0006396 RNA processing Biological Process

GO:0007281 germ cell development Biological Process

GO:0008380 RNA splicing Biological Process

GO:0010172 embryonic body morphogenesis Biological Process

GO:0048589 developmental growth Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005681 spliceosomal complex Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT3G26560

cel:CELE_EEED8.5

ddi:DDB_G0291183

hsa:1659

mmu:217207

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.529

Rank 1 · LXL04_015155 · OH-1004

Cytoplasm0.358

Rank 2 · LXL04_015155 · OH-1004

Cell membrane0.063

Rank 3 · LXL04_015155 · OH-1004

Mitochondrion0.058

Rank 4 · LXL04_015155 · OH-1004

Endoplasmic reticulum0.057

Rank 5 · LXL04_015155 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00575.30S1359-413 aa

PF00270.36DEAD685-836 aa

PF13401.13AAA_22693-816 aa

PF00271.38Helicase_C877-1005 aa

PF04408.30WHD_HA21067-1095 aa

PF21010.3HA2_C1096-1155 aa

PF07717.23OB_NTP_bind1213-1289 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015155	`PF00575.30`	S1	359	413	3.1e-08	34.6
LXL04_015155	`PF00270.36`	DEAD	685	836	1.3e-08	35.5
LXL04_015155	`PF13401.13`	AAA_22	693	816	5.1e-07	30.8
LXL04_015155	`PF00271.38`	Helicase_C	877	1005	8.9e-10	39.5
LXL04_015155	`PF04408.30`	WHD_HA2	1067	1095	5.4e-11	43.0
LXL04_015155	`PF21010.3`	HA2_C	1096	1155	5e-13	50.1
LXL04_015155	`PF07717.23`	OB_NTP_bind	1213	1289	1.4e-26	93.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q38953`	Arabidopsis thaliana	Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5	84.752%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card