LXL04_015097 | RubberDandelionOmics

Gene overview

LXL04_015097

Reference: OH-1004 Chr: Chr03 Coordinates: 63460684-63461148 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

465 bp · LXL04_015097|LXL04_015097|OH1004|cDNA

ATGGCTATTTCAACTGCATCCTCATTGTTTACATCCCCTAACTTTTCCATCAATTTAAAGCCCTCATTAAAATCGACTTCGAACTCCATCAAGTTCAGAAGAGCTCCGATTTCAGCTGCTTACGCCACCGCCGACCGGACGGAGACGGAGACGATTAGATCGTTCCGGAATAGTTCTCCCTCCTCGCTGTACGAGGTGCTGGGAGTTCGAATCGGAGCTGATACACGGGAGGTGAAATCGGCGTACCGGAGATTAGCGAG...

CDS

Download CDS FASTA

465 bp · LXL04_015097|LXL04_015097|OH1004|CDS

ATGGCTATTTCAACTGCATCCTCATTGTTTACATCCCCTAACTTTTCCATCAATTTAAAGCCCTCATTAAAATCGACTTCGAACTCCATCAAGTTCAGAAGAGCTCCGATTTCAGCTGCTTACGCCACCGCCGACCGGACGGAGACGGAGACGATTAGATCGTTCCGGAATAGTTCTCCCTCCTCGCTGTACGAGGTGCTGGGAGTTCGAATCGGAGCTGATACACGGGAGGTGAAATCGGCGTACCGGAGATTAGCGAG...

Protein

Download Protein FASTA

154 aa · LXL04_015097|LXL04_015097|OH1004|PROTEIN

MAISTASSLFTSPNFSINLKPSLKSTSNSIKFRRAPISAAYATADRTETETIRSFRNSSPSSLYEVLGVRIGADTREVKSAYRRLARVLHPDVGSSDSSADEFMKVHSAYATLADPAKRADYDRTLVQKRAGVSSPLRSGSGYRSRRWETDQCW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015097`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015097

Location Chr03:63460684-63461148 (+)

Description Similar to ATJ11: Chaperone protein dnaJ 11, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g36040`	Plays a continuous role in plant development probably in the structural organization of compartments.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015097 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006260 DNA replication Biological Process

GO:0009408 response to heat Biological Process

GO:0042026 protein refolding Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0031072 heat shock protein binding Molecular Function

GO:0051082 unfolded protein binding Molecular Function

KEGG gene cross-reference

ath:AT4G36040

hne:HNE_0761

mlo:mll4755

mth:MTH_1291

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.930

Rank 1 · LXL04_015097 · OH-1004

Nucleus0.070

Rank 2 · LXL04_015097 · OH-1004

Mitochondrion0.043

Rank 3 · LXL04_015097 · OH-1004

Cytoplasm0.023

Rank 4 · LXL04_015097 · OH-1004

Cell membrane0.009

Rank 5 · LXL04_015097 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00226.37DnaJ63-123 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015097	`PF00226.37`	DnaJ	63	123	1.1e-18	67.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FYB5`	Arabidopsis thaliana	Chaperone protein dnaJ 11, chloroplastic	54.369%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card